BLASTX nr result
ID: Cornus23_contig00007825
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00007825 (718 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011079613.1| PREDICTED: kinesin-4-like [Sesamum indicum] 57 9e-06 >ref|XP_011079613.1| PREDICTED: kinesin-4-like [Sesamum indicum] Length = 985 Score = 57.4 bits (137), Expect = 9e-06 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = -2 Query: 114 AMEGALSFYAASVVEVVLQQHGIRSRDLDLESRRAGEA 1 A+EGALSF AASVVE VLQQHG RSRDLD ++RRA EA Sbjct: 3 AIEGALSFSAASVVEDVLQQHGNRSRDLDFDARRAEEA 40