BLASTX nr result
ID: Cornus23_contig00007318
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00007318 (446 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO71567.1| hypothetical protein CISIN_1g0157611mg, partial [... 78 6e-21 ref|XP_010649342.1| PREDICTED: RNA polymerase I-specific transcr... 79 1e-20 emb|CBI37506.3| unnamed protein product [Vitis vinifera] 79 1e-20 gb|KDO71565.1| hypothetical protein CISIN_1g0157611mg, partial [... 78 2e-20 gb|KDO67467.1| hypothetical protein CISIN_1g0074032mg, partial [... 75 4e-20 ref|XP_012067215.1| PREDICTED: RNA polymerase I-specific transcr... 77 1e-19 ref|XP_012067216.1| PREDICTED: RNA polymerase I-specific transcr... 77 1e-19 ref|XP_006483466.1| PREDICTED: RNA polymerase I-specific transcr... 75 1e-19 ref|XP_006467185.1| PREDICTED: RNA polymerase I-specific transcr... 77 1e-19 ref|XP_006483467.1| PREDICTED: RNA polymerase I-specific transcr... 75 1e-19 gb|KDO67466.1| hypothetical protein CISIN_1g0074032mg, partial [... 75 1e-19 ref|XP_011022128.1| PREDICTED: RNA polymerase I-specific transcr... 76 2e-19 ref|XP_002307198.2| RNA polymerase 1 specific transcription init... 76 2e-19 ref|XP_006483561.1| PREDICTED: RNA polymerase I-specific transcr... 74 3e-19 ref|XP_008438040.1| PREDICTED: RNA polymerase I-specific transcr... 73 4e-19 ref|XP_007204094.1| hypothetical protein PRUPE_ppa002914mg [Prun... 73 9e-19 ref|XP_007204151.1| hypothetical protein PRUPE_ppa019726mg [Prun... 73 9e-19 ref|XP_006483559.1| PREDICTED: RNA polymerase I-specific transcr... 74 1e-18 ref|XP_006483560.1| PREDICTED: RNA polymerase I-specific transcr... 74 1e-18 ref|XP_006483734.1| PREDICTED: RNA polymerase I-specific transcr... 74 1e-18 >gb|KDO71567.1| hypothetical protein CISIN_1g0157611mg, partial [Citrus sinensis] Length = 109 Score = 77.8 bits (190), Expect(2) = 6e-21 Identities = 35/47 (74%), Positives = 42/47 (89%) Frame = -2 Query: 412 QVCLPSIVEEFLRQAKAAHLFAVSESFVFDDLLESEFSRVFGGMERL 272 +VCLPS+V EFL+Q+KAAHLF VSESF+F D+LESE SR FGG+ERL Sbjct: 40 KVCLPSVVSEFLQQSKAAHLFTVSESFIFSDMLESELSRAFGGLERL 86 Score = 49.7 bits (117), Expect(2) = 6e-21 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = -1 Query: 272 AFSGMEMLDMFFPFDPCLLKKSDR 201 AF G+E LDMFFPFDPCLLKKSDR Sbjct: 79 AFGGLERLDMFFPFDPCLLKKSDR 102 >ref|XP_010649342.1| PREDICTED: RNA polymerase I-specific transcription initiation factor rrn3 [Vitis vinifera] Length = 627 Score = 79.3 bits (194), Expect(2) = 1e-20 Identities = 39/50 (78%), Positives = 43/50 (86%) Frame = -2 Query: 421 SGCQVCLPSIVEEFLRQAKAAHLFAVSESFVFDDLLESEFSRVFGGMERL 272 S +VCLPSIVEEFLRQAKAA LF VSE+F+F DLLESE SR FGG+ERL Sbjct: 463 SPLKVCLPSIVEEFLRQAKAARLFTVSETFIFSDLLESELSRAFGGIERL 512 Score = 47.4 bits (111), Expect(2) = 1e-20 Identities = 20/24 (83%), Positives = 21/24 (87%) Frame = -1 Query: 272 AFSGMEMLDMFFPFDPCLLKKSDR 201 AF G+E LDMFFPFDPCLLKK DR Sbjct: 505 AFGGIERLDMFFPFDPCLLKKCDR 528 >emb|CBI37506.3| unnamed protein product [Vitis vinifera] Length = 607 Score = 79.3 bits (194), Expect(2) = 1e-20 Identities = 39/50 (78%), Positives = 43/50 (86%) Frame = -2 Query: 421 SGCQVCLPSIVEEFLRQAKAAHLFAVSESFVFDDLLESEFSRVFGGMERL 272 S +VCLPSIVEEFLRQAKAA LF VSE+F+F DLLESE SR FGG+ERL Sbjct: 463 SPLKVCLPSIVEEFLRQAKAARLFTVSETFIFSDLLESELSRAFGGIERL 512 Score = 47.4 bits (111), Expect(2) = 1e-20 Identities = 20/24 (83%), Positives = 21/24 (87%) Frame = -1 Query: 272 AFSGMEMLDMFFPFDPCLLKKSDR 201 AF G+E LDMFFPFDPCLLKK DR Sbjct: 505 AFGGIERLDMFFPFDPCLLKKCDR 528 >gb|KDO71565.1| hypothetical protein CISIN_1g0157611mg, partial [Citrus sinensis] gi|641852701|gb|KDO71566.1| hypothetical protein CISIN_1g0157611mg, partial [Citrus sinensis] Length = 184 Score = 77.8 bits (190), Expect(2) = 2e-20 Identities = 35/47 (74%), Positives = 42/47 (89%) Frame = -2 Query: 412 QVCLPSIVEEFLRQAKAAHLFAVSESFVFDDLLESEFSRVFGGMERL 272 +VCLPS+V EFL+Q+KAAHLF VSESF+F D+LESE SR FGG+ERL Sbjct: 40 KVCLPSVVSEFLQQSKAAHLFTVSESFIFSDMLESELSRAFGGLERL 86 Score = 47.8 bits (112), Expect(2) = 2e-20 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = -1 Query: 272 AFSGMEMLDMFFPFDPCLLKKSD 204 AF G+E LDMFFPFDPCLLKKSD Sbjct: 79 AFGGLERLDMFFPFDPCLLKKSD 101 >gb|KDO67467.1| hypothetical protein CISIN_1g0074032mg, partial [Citrus sinensis] Length = 202 Score = 75.1 bits (183), Expect(2) = 4e-20 Identities = 35/47 (74%), Positives = 42/47 (89%) Frame = -2 Query: 412 QVCLPSIVEEFLRQAKAAHLFAVSESFVFDDLLESEFSRVFGGMERL 272 +VCLPS+V EFL+Q+KAA LF VSE+FVF+DLLESE SR FGG+ERL Sbjct: 133 KVCLPSVVSEFLQQSKAARLFTVSETFVFNDLLESELSRAFGGLERL 179 Score = 49.7 bits (117), Expect(2) = 4e-20 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = -1 Query: 272 AFSGMEMLDMFFPFDPCLLKKSDR 201 AF G+E LDMFFPFDPCLLKKSDR Sbjct: 172 AFGGLERLDMFFPFDPCLLKKSDR 195 >ref|XP_012067215.1| PREDICTED: RNA polymerase I-specific transcription initiation factor RRN3 isoform X1 [Jatropha curcas] gi|643735114|gb|KDP41755.1| hypothetical protein JCGZ_26773 [Jatropha curcas] Length = 628 Score = 77.0 bits (188), Expect(2) = 1e-19 Identities = 36/47 (76%), Positives = 42/47 (89%) Frame = -2 Query: 412 QVCLPSIVEEFLRQAKAAHLFAVSESFVFDDLLESEFSRVFGGMERL 272 +VCLPSIVEEFL+QAKAAHLF E+F+ +DLLESEFSR FGG+ERL Sbjct: 468 KVCLPSIVEEFLKQAKAAHLFTTPETFISEDLLESEFSREFGGLERL 514 Score = 46.2 bits (108), Expect(2) = 1e-19 Identities = 19/24 (79%), Positives = 20/24 (83%) Frame = -1 Query: 269 FSGMEMLDMFFPFDPCLLKKSDRN 198 F G+E LDMFFPFDPCLLK DRN Sbjct: 508 FGGLERLDMFFPFDPCLLKTCDRN 531 >ref|XP_012067216.1| PREDICTED: RNA polymerase I-specific transcription initiation factor RRN3 isoform X2 [Jatropha curcas] Length = 610 Score = 77.0 bits (188), Expect(2) = 1e-19 Identities = 36/47 (76%), Positives = 42/47 (89%) Frame = -2 Query: 412 QVCLPSIVEEFLRQAKAAHLFAVSESFVFDDLLESEFSRVFGGMERL 272 +VCLPSIVEEFL+QAKAAHLF E+F+ +DLLESEFSR FGG+ERL Sbjct: 450 KVCLPSIVEEFLKQAKAAHLFTTPETFISEDLLESEFSREFGGLERL 496 Score = 46.2 bits (108), Expect(2) = 1e-19 Identities = 19/24 (79%), Positives = 20/24 (83%) Frame = -1 Query: 269 FSGMEMLDMFFPFDPCLLKKSDRN 198 F G+E LDMFFPFDPCLLK DRN Sbjct: 490 FGGLERLDMFFPFDPCLLKTCDRN 513 >ref|XP_006483466.1| PREDICTED: RNA polymerase I-specific transcription initiation factor RRN3-like isoform X1 [Citrus sinensis] Length = 628 Score = 75.1 bits (183), Expect(2) = 1e-19 Identities = 35/47 (74%), Positives = 42/47 (89%) Frame = -2 Query: 412 QVCLPSIVEEFLRQAKAAHLFAVSESFVFDDLLESEFSRVFGGMERL 272 +VCLPS+V EFL+Q+KAA LF VSE+FVF+DLLESE SR FGG+ERL Sbjct: 469 KVCLPSVVSEFLQQSKAARLFTVSETFVFNDLLESELSRAFGGLERL 515 Score = 47.8 bits (112), Expect(2) = 1e-19 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = -1 Query: 272 AFSGMEMLDMFFPFDPCLLKKSD 204 AF G+E LDMFFPFDPCLLKKSD Sbjct: 508 AFGGLERLDMFFPFDPCLLKKSD 530 >ref|XP_006467185.1| PREDICTED: RNA polymerase I-specific transcription initiation factor RRN3-like [Citrus sinensis] Length = 588 Score = 76.6 bits (187), Expect(2) = 1e-19 Identities = 35/47 (74%), Positives = 42/47 (89%) Frame = -2 Query: 412 QVCLPSIVEEFLRQAKAAHLFAVSESFVFDDLLESEFSRVFGGMERL 272 +VCLPS+V EFL+Q+KAAHLF VSESF+F D+LESE SR FGG+ERL Sbjct: 429 KVCLPSVVSEFLQQSKAAHLFTVSESFIFSDMLESELSRDFGGLERL 475 Score = 46.2 bits (108), Expect(2) = 1e-19 Identities = 19/22 (86%), Positives = 20/22 (90%) Frame = -1 Query: 269 FSGMEMLDMFFPFDPCLLKKSD 204 F G+E LDMFFPFDPCLLKKSD Sbjct: 469 FGGLERLDMFFPFDPCLLKKSD 490 >ref|XP_006483467.1| PREDICTED: RNA polymerase I-specific transcription initiation factor RRN3-like isoform X2 [Citrus sinensis] Length = 535 Score = 75.1 bits (183), Expect(2) = 1e-19 Identities = 35/47 (74%), Positives = 42/47 (89%) Frame = -2 Query: 412 QVCLPSIVEEFLRQAKAAHLFAVSESFVFDDLLESEFSRVFGGMERL 272 +VCLPS+V EFL+Q+KAA LF VSE+FVF+DLLESE SR FGG+ERL Sbjct: 376 KVCLPSVVSEFLQQSKAARLFTVSETFVFNDLLESELSRAFGGLERL 422 Score = 47.8 bits (112), Expect(2) = 1e-19 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = -1 Query: 272 AFSGMEMLDMFFPFDPCLLKKSD 204 AF G+E LDMFFPFDPCLLKKSD Sbjct: 415 AFGGLERLDMFFPFDPCLLKKSD 437 >gb|KDO67466.1| hypothetical protein CISIN_1g0074032mg, partial [Citrus sinensis] Length = 292 Score = 75.1 bits (183), Expect(2) = 1e-19 Identities = 35/47 (74%), Positives = 42/47 (89%) Frame = -2 Query: 412 QVCLPSIVEEFLRQAKAAHLFAVSESFVFDDLLESEFSRVFGGMERL 272 +VCLPS+V EFL+Q+KAA LF VSE+FVF+DLLESE SR FGG+ERL Sbjct: 133 KVCLPSVVSEFLQQSKAARLFTVSETFVFNDLLESELSRAFGGLERL 179 Score = 47.8 bits (112), Expect(2) = 1e-19 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = -1 Query: 272 AFSGMEMLDMFFPFDPCLLKKSD 204 AF G+E LDMFFPFDPCLLKKSD Sbjct: 172 AFGGLERLDMFFPFDPCLLKKSD 194 >ref|XP_011022128.1| PREDICTED: RNA polymerase I-specific transcription initiation factor rrn3 [Populus euphratica] Length = 637 Score = 76.3 bits (186), Expect(2) = 2e-19 Identities = 34/47 (72%), Positives = 43/47 (91%) Frame = -2 Query: 412 QVCLPSIVEEFLRQAKAAHLFAVSESFVFDDLLESEFSRVFGGMERL 272 +VCLPSIV EFL+QAKAAHLF +S++F+F+DLLES+ SR FGG+ERL Sbjct: 479 EVCLPSIVNEFLKQAKAAHLFTISKAFIFEDLLESDLSRDFGGLERL 525 Score = 46.2 bits (108), Expect(2) = 2e-19 Identities = 19/23 (82%), Positives = 20/23 (86%) Frame = -1 Query: 269 FSGMEMLDMFFPFDPCLLKKSDR 201 F G+E LDMFFPFDPCLLKK DR Sbjct: 519 FGGLERLDMFFPFDPCLLKKCDR 541 >ref|XP_002307198.2| RNA polymerase 1 specific transcription initiation factor RRN3 family protein [Populus trichocarpa] gi|550338523|gb|EEE94194.2| RNA polymerase 1 specific transcription initiation factor RRN3 family protein [Populus trichocarpa] Length = 637 Score = 76.3 bits (186), Expect(2) = 2e-19 Identities = 34/47 (72%), Positives = 43/47 (91%) Frame = -2 Query: 412 QVCLPSIVEEFLRQAKAAHLFAVSESFVFDDLLESEFSRVFGGMERL 272 +VCLPSIV EFL+QAKAAHLF +S++F+F+DLLES+ SR FGG+ERL Sbjct: 479 EVCLPSIVNEFLKQAKAAHLFTISKAFIFEDLLESDLSRDFGGLERL 525 Score = 46.2 bits (108), Expect(2) = 2e-19 Identities = 19/23 (82%), Positives = 20/23 (86%) Frame = -1 Query: 269 FSGMEMLDMFFPFDPCLLKKSDR 201 F G+E LDMFFPFDPCLLKK DR Sbjct: 519 FGGLERLDMFFPFDPCLLKKCDR 541 >ref|XP_006483561.1| PREDICTED: RNA polymerase I-specific transcription initiation factor rrn3-like isoform X3 [Citrus sinensis] Length = 534 Score = 73.6 bits (179), Expect(2) = 3e-19 Identities = 34/47 (72%), Positives = 42/47 (89%) Frame = -2 Query: 412 QVCLPSIVEEFLRQAKAAHLFAVSESFVFDDLLESEFSRVFGGMERL 272 +VCLPS+V EFL+Q+KAA LF VSE+F+F+DLLESE SR FGG+ERL Sbjct: 469 KVCLPSVVSEFLQQSKAARLFTVSETFIFNDLLESELSRDFGGLERL 515 Score = 48.1 bits (113), Expect(2) = 3e-19 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = -1 Query: 269 FSGMEMLDMFFPFDPCLLKKSDR 201 F G+E LDMFFPFDPCLLKKSDR Sbjct: 509 FGGLERLDMFFPFDPCLLKKSDR 531 >ref|XP_008438040.1| PREDICTED: RNA polymerase I-specific transcription initiation factor RRN3 [Cucumis melo] gi|659075244|ref|XP_008438041.1| PREDICTED: RNA polymerase I-specific transcription initiation factor RRN3 [Cucumis melo] gi|659075246|ref|XP_008438042.1| PREDICTED: RNA polymerase I-specific transcription initiation factor RRN3 [Cucumis melo] gi|659075248|ref|XP_008438044.1| PREDICTED: RNA polymerase I-specific transcription initiation factor RRN3 [Cucumis melo] Length = 625 Score = 72.8 bits (177), Expect(2) = 4e-19 Identities = 35/50 (70%), Positives = 43/50 (86%) Frame = -2 Query: 421 SGCQVCLPSIVEEFLRQAKAAHLFAVSESFVFDDLLESEFSRVFGGMERL 272 S +VCLPSIVEEFL+QAK A+LF SE+F+F+ LLESE+SR FGG+ERL Sbjct: 462 SPLKVCLPSIVEEFLQQAKVANLFTPSETFIFNGLLESEYSRSFGGLERL 511 Score = 48.5 bits (114), Expect(2) = 4e-19 Identities = 26/58 (44%), Positives = 30/58 (51%) Frame = -1 Query: 272 AFSGMEMLDMFFPFDPCLLKKSDRNMF*SLGLNLRGIYLKLHVT*WEI*VDRYKRWEE 99 +F G+E LDMFFPFDPCLLKK DR YL+ H W + Y EE Sbjct: 504 SFGGLERLDMFFPFDPCLLKKCDR-------------YLRPHFVYWSMVRPTYAEEEE 548 >ref|XP_007204094.1| hypothetical protein PRUPE_ppa002914mg [Prunus persica] gi|462399625|gb|EMJ05293.1| hypothetical protein PRUPE_ppa002914mg [Prunus persica] Length = 622 Score = 72.8 bits (177), Expect(2) = 9e-19 Identities = 38/50 (76%), Positives = 39/50 (78%) Frame = -2 Query: 421 SGCQVCLPSIVEEFLRQAKAAHLFAVSESFVFDDLLESEFSRVFGGMERL 272 S +VCLPSIV EFLRQAKAA LF SE F FDD LESE SR FGGMERL Sbjct: 459 SPLKVCLPSIVLEFLRQAKAARLFMTSEKFNFDDYLESELSREFGGMERL 508 Score = 47.4 bits (111), Expect(2) = 9e-19 Identities = 20/22 (90%), Positives = 20/22 (90%) Frame = -1 Query: 269 FSGMEMLDMFFPFDPCLLKKSD 204 F GME LDMFFPFDPCLLKKSD Sbjct: 502 FGGMERLDMFFPFDPCLLKKSD 523 >ref|XP_007204151.1| hypothetical protein PRUPE_ppa019726mg [Prunus persica] gi|462399682|gb|EMJ05350.1| hypothetical protein PRUPE_ppa019726mg [Prunus persica] Length = 569 Score = 72.8 bits (177), Expect(2) = 9e-19 Identities = 38/50 (76%), Positives = 39/50 (78%) Frame = -2 Query: 421 SGCQVCLPSIVEEFLRQAKAAHLFAVSESFVFDDLLESEFSRVFGGMERL 272 S +VCLPSIV EFLRQAKAA LF SE F FDD LESE SR FGGMERL Sbjct: 404 SPLKVCLPSIVLEFLRQAKAARLFMTSEKFNFDDYLESELSREFGGMERL 453 Score = 47.4 bits (111), Expect(2) = 9e-19 Identities = 20/22 (90%), Positives = 20/22 (90%) Frame = -1 Query: 269 FSGMEMLDMFFPFDPCLLKKSD 204 F GME LDMFFPFDPCLLKKSD Sbjct: 447 FGGMERLDMFFPFDPCLLKKSD 468 >ref|XP_006483559.1| PREDICTED: RNA polymerase I-specific transcription initiation factor rrn3-like isoform X1 [Citrus sinensis] Length = 628 Score = 73.6 bits (179), Expect(2) = 1e-18 Identities = 34/47 (72%), Positives = 42/47 (89%) Frame = -2 Query: 412 QVCLPSIVEEFLRQAKAAHLFAVSESFVFDDLLESEFSRVFGGMERL 272 +VCLPS+V EFL+Q+KAA LF VSE+F+F+DLLESE SR FGG+ERL Sbjct: 469 KVCLPSVVSEFLQQSKAARLFTVSETFIFNDLLESELSRDFGGLERL 515 Score = 46.2 bits (108), Expect(2) = 1e-18 Identities = 19/22 (86%), Positives = 20/22 (90%) Frame = -1 Query: 269 FSGMEMLDMFFPFDPCLLKKSD 204 F G+E LDMFFPFDPCLLKKSD Sbjct: 509 FGGLERLDMFFPFDPCLLKKSD 530 >ref|XP_006483560.1| PREDICTED: RNA polymerase I-specific transcription initiation factor rrn3-like isoform X2 [Citrus sinensis] Length = 535 Score = 73.6 bits (179), Expect(2) = 1e-18 Identities = 34/47 (72%), Positives = 42/47 (89%) Frame = -2 Query: 412 QVCLPSIVEEFLRQAKAAHLFAVSESFVFDDLLESEFSRVFGGMERL 272 +VCLPS+V EFL+Q+KAA LF VSE+F+F+DLLESE SR FGG+ERL Sbjct: 376 KVCLPSVVSEFLQQSKAARLFTVSETFIFNDLLESELSRDFGGLERL 422 Score = 46.2 bits (108), Expect(2) = 1e-18 Identities = 19/22 (86%), Positives = 20/22 (90%) Frame = -1 Query: 269 FSGMEMLDMFFPFDPCLLKKSD 204 F G+E LDMFFPFDPCLLKKSD Sbjct: 416 FGGLERLDMFFPFDPCLLKKSD 437 >ref|XP_006483734.1| PREDICTED: RNA polymerase I-specific transcription initiation factor RRN3-like [Citrus sinensis] Length = 315 Score = 73.6 bits (179), Expect(2) = 1e-18 Identities = 34/47 (72%), Positives = 42/47 (89%) Frame = -2 Query: 412 QVCLPSIVEEFLRQAKAAHLFAVSESFVFDDLLESEFSRVFGGMERL 272 +VCLPS+V EFL+Q+KAA LF VSE+F+F+DLLESE SR FGG+ERL Sbjct: 156 KVCLPSVVSEFLQQSKAARLFTVSETFIFNDLLESELSRDFGGLERL 202 Score = 46.2 bits (108), Expect(2) = 1e-18 Identities = 19/22 (86%), Positives = 20/22 (90%) Frame = -1 Query: 269 FSGMEMLDMFFPFDPCLLKKSD 204 F G+E LDMFFPFDPCLLKKSD Sbjct: 196 FGGLERLDMFFPFDPCLLKKSD 217