BLASTX nr result
ID: Cornus23_contig00007219
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00007219 (347 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AJS14462.1| hypothetical chloroplast RF21 [Ruellia breedlovei] 64 3e-08 gb|KJB15229.1| hypothetical protein B456_002G166000 [Gossypium r... 63 7e-08 gb|AEK78271.1| hypothetical chloroplast RF2 [Rivina humilis] 63 7e-08 gb|AEK71532.1| hypothetical chloroplast RF2 [Ochna mossambicensis] 63 7e-08 gb|AKJ77765.1| Ycf2 (chloroplast) [Perilla frutescens] gi|827346... 62 2e-07 ref|YP_009144558.1| Ycf2 (chloroplast) [Rosmarinus officinalis] ... 62 2e-07 ref|YP_007507155.1| hypothetical chloroplast RF2 (chloroplast) [... 62 2e-07 gb|AEK78225.1| hypothetical chloroplast RF2 [Halophytum ameghinoi] 62 2e-07 gb|ADD30886.1| putative RF2 protein (chloroplast) [Nelumbo nucif... 62 2e-07 gb|AFH01584.1| hypothetical chloroplast RF21 (chloroplast) [Nelu... 62 2e-07 gb|AEK78231.1| hypothetical chloroplast RF2 [Mirabilis jalapa] 62 2e-07 ref|YP_009093993.1| hypothetical chloroplast RF21 (chloroplast) ... 62 2e-07 ref|YP_004563911.1| hypothetical chloroplast RF2 [Nelumbo lutea]... 62 2e-07 ref|YP_004327722.1| hypothetical chloroplast RF2 [Hevea brasilie... 62 2e-07 gb|ALN11646.1| hypothetical chloroplast RF21 (chloroplast) [Scut... 61 3e-07 ref|YP_009171824.1| Ycf2 (chloroplast) [Solanum commersonii] gi|... 61 3e-07 gb|ALD50403.1| Ycf2 (chloroplast) [Capsicum baccatum var. baccat... 61 3e-07 ref|YP_009164603.1| hypothetical protein Ycf2 (chloroplast) [Lat... 61 3e-07 ref|YP_398908.1| Ycf2 [Nicotiana tomentosiformis] gi|81301647|re... 61 3e-07 ref|YP_009162305.1| hypothetical chloroplast RF2 (chloroplast) [... 61 3e-07 >gb|AJS14462.1| hypothetical chloroplast RF21 [Ruellia breedlovei] Length = 2266 Score = 64.3 bits (155), Expect = 3e-08 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = +2 Query: 2 SRYSHQELFADEKMSKHLLTSQINPPTSIHKHWFVKN 112 S +SH+ELFADE+MSK LLTSQ +PPTSI+KHWF+KN Sbjct: 2157 SVFSHRELFADEEMSKGLLTSQTDPPTSIYKHWFIKN 2193 >gb|KJB15229.1| hypothetical protein B456_002G166000 [Gossypium raimondii] Length = 1252 Score = 63.2 bits (152), Expect = 7e-08 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = +2 Query: 2 SRYSHQELFADEKMSKHLLTSQINPPTSIHKHWFVKNM 115 S +SHQE F DE+MSK LLTSQ NPPTSI+K WF+KNM Sbjct: 1127 SVFSHQEFFEDEEMSKGLLTSQTNPPTSIYKRWFIKNM 1164 >gb|AEK78271.1| hypothetical chloroplast RF2 [Rivina humilis] Length = 2195 Score = 63.2 bits (152), Expect = 7e-08 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +2 Query: 2 SRYSHQELFADEKMSKHLLTSQINPPTSIHKHWFVKN 112 S +SH+E FADEKMSK LLTSQI+PPTSI+K WF+KN Sbjct: 2086 SVFSHREFFADEKMSKGLLTSQIDPPTSIYKRWFIKN 2122 >gb|AEK71532.1| hypothetical chloroplast RF2 [Ochna mossambicensis] Length = 2264 Score = 63.2 bits (152), Expect = 7e-08 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +2 Query: 2 SRYSHQELFADEKMSKHLLTSQINPPTSIHKHWFVKN 112 S +SHQE FADE+MSK LLTSQ NPPTSI+K WF+KN Sbjct: 2157 SVFSHQEFFADEEMSKGLLTSQTNPPTSIYKRWFIKN 2193 >gb|AKJ77765.1| Ycf2 (chloroplast) [Perilla frutescens] gi|827346597|gb|AKJ77783.1| Ycf2 (chloroplast) [Perilla frutescens] Length = 2279 Score = 62.0 bits (149), Expect = 2e-07 Identities = 27/37 (72%), Positives = 34/37 (91%) Frame = +2 Query: 2 SRYSHQELFADEKMSKHLLTSQINPPTSIHKHWFVKN 112 S +SH+ELFADE+MSK LLTSQ++PPTSI+K WF+KN Sbjct: 2170 SVFSHRELFADEEMSKGLLTSQMDPPTSIYKRWFIKN 2206 >ref|YP_009144558.1| Ycf2 (chloroplast) [Rosmarinus officinalis] gi|836643371|ref|YP_009144577.1| Ycf2 (chloroplast) [Rosmarinus officinalis] gi|827345130|gb|AKJ76714.1| Ycf2 (chloroplast) [Rosmarinus officinalis] gi|827345131|gb|AKJ76715.1| Ycf2 (chloroplast) [Rosmarinus officinalis] Length = 2277 Score = 62.0 bits (149), Expect = 2e-07 Identities = 27/37 (72%), Positives = 34/37 (91%) Frame = +2 Query: 2 SRYSHQELFADEKMSKHLLTSQINPPTSIHKHWFVKN 112 S +SH+ELFADE+MSK LLTSQ++PPTSI+K WF+KN Sbjct: 2168 SVFSHRELFADEEMSKGLLTSQMDPPTSIYKRWFIKN 2204 >ref|YP_007507155.1| hypothetical chloroplast RF2 (chloroplast) [Salvia miltiorrhiza] gi|459014556|ref|YP_007507174.1| hypothetical chloroplast RF2 (chloroplast) [Salvia miltiorrhiza] gi|401879785|gb|AFQ30972.1| hypothetical chloroplast RF2 (chloroplast) [Salvia miltiorrhiza] gi|401879806|gb|AFQ30993.1| hypothetical chloroplast RF2 (chloroplast) [Salvia miltiorrhiza] gi|573461995|emb|CCQ71664.1| Ycf2 (chloroplast) [Salvia miltiorrhiza] gi|573462016|emb|CCQ71685.1| Ycf2 (chloroplast) [Salvia miltiorrhiza] Length = 2283 Score = 62.0 bits (149), Expect = 2e-07 Identities = 27/37 (72%), Positives = 34/37 (91%) Frame = +2 Query: 2 SRYSHQELFADEKMSKHLLTSQINPPTSIHKHWFVKN 112 S +SH+ELFADE+MSK LLTSQ++PPTSI+K WF+KN Sbjct: 2174 SVFSHRELFADEEMSKGLLTSQMDPPTSIYKRWFIKN 2210 >gb|AEK78225.1| hypothetical chloroplast RF2 [Halophytum ameghinoi] Length = 2253 Score = 62.0 bits (149), Expect = 2e-07 Identities = 26/37 (70%), Positives = 34/37 (91%) Frame = +2 Query: 2 SRYSHQELFADEKMSKHLLTSQINPPTSIHKHWFVKN 112 S +SH+E FADE+MSK LLTS+++PPTSI+KHWF+KN Sbjct: 2144 SVFSHREFFADEEMSKGLLTSKMDPPTSIYKHWFIKN 2180 >gb|ADD30886.1| putative RF2 protein (chloroplast) [Nelumbo nucifera] Length = 2304 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +2 Query: 2 SRYSHQELFADEKMSKHLLTSQINPPTSIHKHWFVKN 112 S +S +E FADE+MSK LLTSQ NPPTSI+KHWF+KN Sbjct: 2186 SVFSRREFFADEEMSKGLLTSQTNPPTSIYKHWFIKN 2222 >gb|AFH01584.1| hypothetical chloroplast RF21 (chloroplast) [Nelumbo lutea] gi|383286951|gb|AFH01600.1| hypothetical chloroplast RF21 (chloroplast) [Nelumbo lutea] Length = 2304 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +2 Query: 2 SRYSHQELFADEKMSKHLLTSQINPPTSIHKHWFVKN 112 S +S +E FADE+MSK LLTSQ NPPTSI+KHWF+KN Sbjct: 2186 SVFSRREFFADEEMSKGLLTSQTNPPTSIYKHWFIKN 2222 >gb|AEK78231.1| hypothetical chloroplast RF2 [Mirabilis jalapa] Length = 2269 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = +2 Query: 2 SRYSHQELFADEKMSKHLLTSQINPPTSIHKHWFVKN 112 S +SH+E FADE+MSK LLTSQI+PPTSI+K WF+KN Sbjct: 2160 SVFSHREFFADEEMSKGLLTSQIDPPTSIYKRWFIKN 2196 >ref|YP_009093993.1| hypothetical chloroplast RF21 (chloroplast) [Nelumbo nucifera] gi|700491290|ref|YP_009094010.1| hypothetical chloroplast RF21 (chloroplast) [Nelumbo nucifera] gi|224474267|gb|ACN49453.1| hypothetical chloroplast RF2 (chloroplast) [Nelumbo nucifera] gi|224474284|gb|ACN49470.1| hypothetical chloroplast RF2 (chloroplast) [Nelumbo nucifera] gi|340807030|gb|AEK71646.1| hypothetical chloroplast RF2 [Nelumbo nucifera] gi|383286841|gb|AFH01491.1| hypothetical chloroplast RF21 (chloroplast) [Nelumbo nucifera] gi|383286862|gb|AFH01512.1| hypothetical chloroplast RF21 (chloroplast) [Nelumbo nucifera] gi|519666955|gb|AGO98567.1| hypothetical chloroplast RF21 (chloroplast) [Nelumbo nucifera] gi|519666972|gb|AGO98584.1| hypothetical chloroplast RF21 (chloroplast) [Nelumbo nucifera] gi|725824088|gb|AIY33867.1| photosystem I assembly protein Ycf2 (chloroplast) [Nelumbo nucifera] gi|725824105|gb|AIY33884.1| photosystem I assembly protein Ycf2 (chloroplast) [Nelumbo nucifera] Length = 2310 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +2 Query: 2 SRYSHQELFADEKMSKHLLTSQINPPTSIHKHWFVKN 112 S +S +E FADE+MSK LLTSQ NPPTSI+KHWF+KN Sbjct: 2192 SVFSRREFFADEEMSKGLLTSQTNPPTSIYKHWFIKN 2228 >ref|YP_004563911.1| hypothetical chloroplast RF2 [Nelumbo lutea] gi|334362011|ref|YP_004563928.1| hypothetical chloroplast RF2 [Nelumbo lutea] gi|224474179|gb|ACN49368.1| hypothetical chloroplast RF2 (chloroplast) [Nelumbo lutea] gi|224474196|gb|ACN49385.1| hypothetical chloroplast RF2 (chloroplast) [Nelumbo lutea] Length = 2304 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +2 Query: 2 SRYSHQELFADEKMSKHLLTSQINPPTSIHKHWFVKN 112 S +S +E FADE+MSK LLTSQ NPPTSI+KHWF+KN Sbjct: 2186 SVFSRREFFADEEMSKGLLTSQTNPPTSIYKHWFIKN 2222 >ref|YP_004327722.1| hypothetical chloroplast RF2 [Hevea brasiliensis] gi|326909454|ref|YP_004327705.1| hypothetical chloroplast RF2 [Hevea brasiliensis] gi|308523548|gb|ADO33598.1| hypothetical chloroplast RF2 [Hevea brasiliensis] gi|308523568|gb|ADO33618.1| hypothetical chloroplast RF2 [Hevea brasiliensis] Length = 2303 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/38 (71%), Positives = 33/38 (86%) Frame = +2 Query: 2 SRYSHQELFADEKMSKHLLTSQINPPTSIHKHWFVKNM 115 S +SH+E FADE+MSK LLTSQ +PPTSI+K WF+KNM Sbjct: 2194 SVFSHREFFADEEMSKGLLTSQTDPPTSIYKRWFIKNM 2231 >gb|ALN11646.1| hypothetical chloroplast RF21 (chloroplast) [Scutellaria insignis] gi|949600214|gb|ALN11665.1| hypothetical chloroplast RF21 (chloroplast) [Scutellaria insignis] Length = 2271 Score = 61.2 bits (147), Expect = 3e-07 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = +2 Query: 2 SRYSHQELFADEKMSKHLLTSQINPPTSIHKHWFVKN 112 S +SH+ELFADE+MSK LLTSQ +PPTSI+K WF+KN Sbjct: 2162 SVFSHRELFADEEMSKGLLTSQTDPPTSIYKRWFIKN 2198 >ref|YP_009171824.1| Ycf2 (chloroplast) [Solanum commersonii] gi|938339734|ref|YP_009171844.1| Ycf2 (chloroplast) [Solanum commersonii] gi|833204663|gb|AKM21901.1| Ycf2 (chloroplast) [Solanum commersonii] gi|833204683|gb|AKM21921.1| Ycf2 (chloroplast) [Solanum commersonii] Length = 2278 Score = 61.2 bits (147), Expect = 3e-07 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = +2 Query: 2 SRYSHQELFADEKMSKHLLTSQINPPTSIHKHWFVKN 112 S +SH+ELFADE+MSK LLTSQ +PPTSI+K WF+KN Sbjct: 2169 SVFSHRELFADEEMSKGLLTSQTDPPTSIYKRWFIKN 2205 >gb|ALD50403.1| Ycf2 (chloroplast) [Capsicum baccatum var. baccatum] gi|926658275|gb|ALD50423.1| Ycf2 (chloroplast) [Capsicum baccatum var. baccatum] Length = 2290 Score = 61.2 bits (147), Expect = 3e-07 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = +2 Query: 2 SRYSHQELFADEKMSKHLLTSQINPPTSIHKHWFVKN 112 S +SH+ELFADE+MSK LLTSQ +PPTSI+K WF+KN Sbjct: 2181 SVFSHRELFADEEMSKGLLTSQTDPPTSIYKRWFIKN 2217 >ref|YP_009164603.1| hypothetical protein Ycf2 (chloroplast) [Lathraea squamaria] gi|927372320|ref|YP_009164611.1| hypothetical protein Ycf2 (chloroplast) [Lathraea squamaria] gi|746590319|gb|AJD76835.1| hypothetical protein Ycf2 (chloroplast) [Lathraea squamaria] gi|746590327|gb|AJD76843.1| hypothetical protein Ycf2 (chloroplast) [Lathraea squamaria] Length = 2261 Score = 61.2 bits (147), Expect = 3e-07 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = +2 Query: 2 SRYSHQELFADEKMSKHLLTSQINPPTSIHKHWFVKN 112 S +SH+ELFADE+MSK LLTSQ +PPTSI+K WF+KN Sbjct: 2155 SVFSHRELFADEEMSKGLLTSQTDPPTSIYKRWFIKN 2191 >ref|YP_398908.1| Ycf2 [Nicotiana tomentosiformis] gi|81301647|ref|YP_398942.1| Ycf2 [Nicotiana tomentosiformis] gi|109896303|sp|Q33BV3.1|YCF2_NICTO RecName: Full=Protein Ycf2 gi|80750971|dbj|BAE48047.1| Ycf2 protein [Nicotiana tomentosiformis] gi|80751006|dbj|BAE48082.1| Ycf2 protein [Nicotiana tomentosiformis] Length = 2280 Score = 61.2 bits (147), Expect = 3e-07 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = +2 Query: 2 SRYSHQELFADEKMSKHLLTSQINPPTSIHKHWFVKN 112 S +SH+ELFADE+MSK LLTSQ +PPTSI+K WF+KN Sbjct: 2171 SVFSHRELFADEEMSKGLLTSQTDPPTSIYKRWFIKN 2207 >ref|YP_009162305.1| hypothetical chloroplast RF2 (chloroplast) [Scutellaria baicalensis] gi|910312663|ref|YP_009162324.1| hypothetical chloroplast RF2 (chloroplast) [Scutellaria baicalensis] gi|827345826|gb|AKJ77127.1| hypothetical chloroplast RF2 (chloroplast) [Scutellaria baicalensis] gi|827345827|gb|AKJ77128.1| hypothetical chloroplast RF2 (chloroplast) [Scutellaria baicalensis] Length = 2289 Score = 61.2 bits (147), Expect = 3e-07 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = +2 Query: 2 SRYSHQELFADEKMSKHLLTSQINPPTSIHKHWFVKN 112 S +SH+ELFADE+MSK LLTSQ +PPTSI+K WF+KN Sbjct: 2180 SVFSHRELFADEEMSKGLLTSQTDPPTSIYKRWFIKN 2216