BLASTX nr result
ID: Cornus23_contig00007050
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00007050 (273 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO71301.1| hypothetical protein CISIN_1g045611mg, partial [C... 112 1e-22 gb|KDO37877.1| hypothetical protein CISIN_1g039645mg [Citrus sin... 112 1e-22 ref|XP_006466995.1| PREDICTED: heavy metal-associated isoprenyla... 112 1e-22 ref|XP_006359700.1| PREDICTED: heavy metal-associated isoprenyla... 110 3e-22 ref|XP_004231044.1| PREDICTED: heavy metal-associated isoprenyla... 110 3e-22 ref|XP_006282751.1| hypothetical protein CARUB_v10005941mg [Caps... 109 7e-22 ref|XP_012837190.1| PREDICTED: heavy metal-associated isoprenyla... 108 2e-21 gb|KNA16033.1| hypothetical protein SOVF_092620 [Spinacia oleracea] 108 2e-21 ref|NP_195570.1| farnesylated protein 6 [Arabidopsis thaliana] g... 107 3e-21 gb|AAM60879.1| farnesylated protein (ATFP6) [Arabidopsis thaliana] 107 3e-21 ref|XP_009791644.1| PREDICTED: heavy metal-associated isoprenyla... 107 4e-21 ref|XP_009605894.1| PREDICTED: heavy metal-associated isoprenyla... 107 5e-21 ref|XP_013597983.1| PREDICTED: heavy metal-associated isoprenyla... 106 6e-21 ref|XP_013622814.1| PREDICTED: heavy metal-associated isoprenyla... 106 6e-21 ref|XP_009109542.1| PREDICTED: heavy metal-associated isoprenyla... 106 6e-21 ref|XP_009101937.1| PREDICTED: heavy metal-associated isoprenyla... 106 6e-21 ref|XP_006411650.1| hypothetical protein EUTSA_v10026471mg [Eutr... 106 6e-21 ref|XP_007041823.1| Farnesylated protein 6 isoform 1 [Theobroma ... 106 6e-21 ref|XP_010531538.1| PREDICTED: heavy metal-associated isoprenyla... 106 8e-21 ref|XP_010446365.1| PREDICTED: heavy metal-associated isoprenyla... 106 8e-21 >gb|KDO71301.1| hypothetical protein CISIN_1g045611mg, partial [Citrus sinensis] Length = 181 Score = 112 bits (280), Expect = 1e-22 Identities = 54/74 (72%), Positives = 66/74 (89%), Gaps = 1/74 (1%) Frame = +2 Query: 53 MGVLDYISDRIDF-SRSHSNKKLKKRKQLQTVEIKVRIDCEGCERKVKRSVEGMKGVTQV 229 MG L+Y+S+ DF SR HS++KLKKRKQLQTVEIK+++DCEGCER+VK+SVEGMKGVTQV Sbjct: 24 MGFLEYVSELCDFESRWHSHRKLKKRKQLQTVEIKIKMDCEGCERRVKKSVEGMKGVTQV 83 Query: 230 MLEPKQHKLTVTGY 271 ++PKQ KLTV GY Sbjct: 84 EVDPKQSKLTVIGY 97 >gb|KDO37877.1| hypothetical protein CISIN_1g039645mg [Citrus sinensis] Length = 188 Score = 112 bits (280), Expect = 1e-22 Identities = 54/74 (72%), Positives = 66/74 (89%), Gaps = 1/74 (1%) Frame = +2 Query: 53 MGVLDYISDRIDF-SRSHSNKKLKKRKQLQTVEIKVRIDCEGCERKVKRSVEGMKGVTQV 229 MG L+Y+S+ DF SR HS++KLKKRKQLQTVEIK+++DCEGCER+VK+SVEGMKGVTQV Sbjct: 31 MGFLEYVSELCDFESRWHSHRKLKKRKQLQTVEIKIKMDCEGCERRVKKSVEGMKGVTQV 90 Query: 230 MLEPKQHKLTVTGY 271 ++PKQ KLTV GY Sbjct: 91 EVDPKQSKLTVIGY 104 >ref|XP_006466995.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26-like [Citrus sinensis] Length = 158 Score = 112 bits (280), Expect = 1e-22 Identities = 54/74 (72%), Positives = 66/74 (89%), Gaps = 1/74 (1%) Frame = +2 Query: 53 MGVLDYISDRIDF-SRSHSNKKLKKRKQLQTVEIKVRIDCEGCERKVKRSVEGMKGVTQV 229 MG L+Y+S+ DF SR HS++KLKKRKQLQTVEIK+++DCEGCER+VK+SVEGMKGVTQV Sbjct: 1 MGFLEYVSELCDFESRWHSHRKLKKRKQLQTVEIKIKMDCEGCERRVKKSVEGMKGVTQV 60 Query: 230 MLEPKQHKLTVTGY 271 ++PKQ KLTV GY Sbjct: 61 EVDPKQSKLTVIGY 74 >ref|XP_006359700.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26-like [Solanum tuberosum] Length = 153 Score = 110 bits (276), Expect = 3e-22 Identities = 55/73 (75%), Positives = 62/73 (84%) Frame = +2 Query: 53 MGVLDYISDRIDFSRSHSNKKLKKRKQLQTVEIKVRIDCEGCERKVKRSVEGMKGVTQVM 232 MGVLD+ISD D S HS K K+RKQLQTVEIKV++DCEGCERKV+RSVEGMKGV+ V Sbjct: 1 MGVLDHISDMFDCSSQHS--KHKRRKQLQTVEIKVKMDCEGCERKVRRSVEGMKGVSSVT 58 Query: 233 LEPKQHKLTVTGY 271 +EPKQHKLTV GY Sbjct: 59 IEPKQHKLTVVGY 71 >ref|XP_004231044.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26-like [Solanum lycopersicum] Length = 153 Score = 110 bits (276), Expect = 3e-22 Identities = 55/73 (75%), Positives = 62/73 (84%) Frame = +2 Query: 53 MGVLDYISDRIDFSRSHSNKKLKKRKQLQTVEIKVRIDCEGCERKVKRSVEGMKGVTQVM 232 MGVLD+ISD D S HS K K+RKQLQTVEIKV++DCEGCERKV+RSVEGMKGV+ V Sbjct: 1 MGVLDHISDMFDCSSEHS--KHKRRKQLQTVEIKVKMDCEGCERKVRRSVEGMKGVSSVT 58 Query: 233 LEPKQHKLTVTGY 271 +EPKQHKLTV GY Sbjct: 59 IEPKQHKLTVVGY 71 >ref|XP_006282751.1| hypothetical protein CARUB_v10005941mg [Capsella rubella] gi|482551456|gb|EOA15649.1| hypothetical protein CARUB_v10005941mg [Capsella rubella] Length = 153 Score = 109 bits (273), Expect = 7e-22 Identities = 53/73 (72%), Positives = 61/73 (83%) Frame = +2 Query: 53 MGVLDYISDRIDFSRSHSNKKLKKRKQLQTVEIKVRIDCEGCERKVKRSVEGMKGVTQVM 232 MGVLD++SD D S H K+KKRKQLQTVEIKV++DCEGCERKV+RSVEGMKGV+ V Sbjct: 1 MGVLDHVSDMFDCSHGH---KIKKRKQLQTVEIKVKMDCEGCERKVRRSVEGMKGVSSVT 57 Query: 233 LEPKQHKLTVTGY 271 LEPK HK+TV GY Sbjct: 58 LEPKSHKVTVVGY 70 >ref|XP_012837190.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26-like [Erythranthe guttatus] gi|604333606|gb|EYU37957.1| hypothetical protein MIMGU_mgv1a015538mg [Erythranthe guttata] Length = 154 Score = 108 bits (270), Expect = 2e-21 Identities = 53/73 (72%), Positives = 61/73 (83%) Frame = +2 Query: 53 MGVLDYISDRIDFSRSHSNKKLKKRKQLQTVEIKVRIDCEGCERKVKRSVEGMKGVTQVM 232 MG LD++S+ D S HS KLKKRKQLQTV+IK++IDCEGCERKV+RSVEGMKGVT V Sbjct: 1 MGALDHLSNMFDCSSGHS--KLKKRKQLQTVDIKIKIDCEGCERKVRRSVEGMKGVTSVE 58 Query: 233 LEPKQHKLTVTGY 271 + PKQHKLTV GY Sbjct: 59 ITPKQHKLTVIGY 71 >gb|KNA16033.1| hypothetical protein SOVF_092620 [Spinacia oleracea] Length = 155 Score = 108 bits (269), Expect = 2e-21 Identities = 54/73 (73%), Positives = 62/73 (84%) Frame = +2 Query: 53 MGVLDYISDRIDFSRSHSNKKLKKRKQLQTVEIKVRIDCEGCERKVKRSVEGMKGVTQVM 232 MGV+D+ISD D S HS+K KRKQLQTVEIK++IDCEGCERKV+RSVEGM+GVTQV Sbjct: 1 MGVMDHISDYFDCSGGHSHKH--KRKQLQTVEIKIKIDCEGCERKVRRSVEGMEGVTQVD 58 Query: 233 LEPKQHKLTVTGY 271 +EPKQ KLTV GY Sbjct: 59 IEPKQSKLTVVGY 71 >ref|NP_195570.1| farnesylated protein 6 [Arabidopsis thaliana] gi|75213637|sp|Q9SZN7.1|HIP26_ARATH RecName: Full=Heavy metal-associated isoprenylated plant protein 26; Short=AtHIPP26; AltName: Full=Farnesylated protein 6; Short=AtFP6; Flags: Precursor gi|11692850|gb|AAG40028.1|AF324677_1 AT4g38580 [Arabidopsis thaliana] gi|11908068|gb|AAG41463.1|AF326881_1 putative farnesylated protein [Arabidopsis thaliana] gi|12642882|gb|AAK00383.1|AF339701_1 putative farnesylated protein ATFP6 [Arabidopsis thaliana] gi|14190521|gb|AAK55741.1|AF380660_1 AT4g38580/F20M13_140 [Arabidopsis thaliana] gi|4467145|emb|CAB37514.1| farnesylated protein (ATFP6) [Arabidopsis thaliana] gi|7270841|emb|CAB80522.1| farnesylated protein (ATFP6) [Arabidopsis thaliana] gi|15810115|gb|AAL06983.1| AT4g38580/F20M13_140 [Arabidopsis thaliana] gi|332661550|gb|AEE86950.1| farnesylated protein 6 [Arabidopsis thaliana] Length = 153 Score = 107 bits (268), Expect = 3e-21 Identities = 52/73 (71%), Positives = 61/73 (83%) Frame = +2 Query: 53 MGVLDYISDRIDFSRSHSNKKLKKRKQLQTVEIKVRIDCEGCERKVKRSVEGMKGVTQVM 232 MGVLD++S+ D S H K+KKRKQLQTVEIKV++DCEGCERKV+RSVEGMKGV+ V Sbjct: 1 MGVLDHVSEMFDCSHGH---KIKKRKQLQTVEIKVKMDCEGCERKVRRSVEGMKGVSSVT 57 Query: 233 LEPKQHKLTVTGY 271 LEPK HK+TV GY Sbjct: 58 LEPKAHKVTVVGY 70 >gb|AAM60879.1| farnesylated protein (ATFP6) [Arabidopsis thaliana] Length = 153 Score = 107 bits (268), Expect = 3e-21 Identities = 52/73 (71%), Positives = 61/73 (83%) Frame = +2 Query: 53 MGVLDYISDRIDFSRSHSNKKLKKRKQLQTVEIKVRIDCEGCERKVKRSVEGMKGVTQVM 232 MGVLD++S+ D S H K+KKRKQLQTVEIKV++DCEGCERKV+RSVEGMKGV+ V Sbjct: 1 MGVLDHVSEMFDCSHGH---KIKKRKQLQTVEIKVKMDCEGCERKVRRSVEGMKGVSSVT 57 Query: 233 LEPKQHKLTVTGY 271 LEPK HK+TV GY Sbjct: 58 LEPKAHKVTVVGY 70 >ref|XP_009791644.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26-like [Nicotiana sylvestris] Length = 155 Score = 107 bits (267), Expect = 4e-21 Identities = 52/73 (71%), Positives = 62/73 (84%) Frame = +2 Query: 53 MGVLDYISDRIDFSRSHSNKKLKKRKQLQTVEIKVRIDCEGCERKVKRSVEGMKGVTQVM 232 MGV+D+ISD D S S+ K K+RKQLQTVE+KV++DCEGCERKV+RSVEGMKGV+ V Sbjct: 1 MGVIDHISDMFDCSTG-SHSKHKRRKQLQTVEVKVKMDCEGCERKVRRSVEGMKGVSSVT 59 Query: 233 LEPKQHKLTVTGY 271 +EPKQHKLTV GY Sbjct: 60 IEPKQHKLTVVGY 72 >ref|XP_009605894.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26-like [Nicotiana tomentosiformis] Length = 155 Score = 107 bits (266), Expect = 5e-21 Identities = 52/73 (71%), Positives = 62/73 (84%) Frame = +2 Query: 53 MGVLDYISDRIDFSRSHSNKKLKKRKQLQTVEIKVRIDCEGCERKVKRSVEGMKGVTQVM 232 MGV+D+ISD D S S+ K K+RKQLQTVE+KV++DCEGCERKV+RSVEGMKGV+ V Sbjct: 1 MGVIDHISDMFDCSTG-SHSKHKRRKQLQTVEVKVKMDCEGCERKVRRSVEGMKGVSSVT 59 Query: 233 LEPKQHKLTVTGY 271 +EPKQHKLTV GY Sbjct: 60 VEPKQHKLTVVGY 72 >ref|XP_013597983.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26-like [Brassica oleracea var. oleracea] Length = 153 Score = 106 bits (265), Expect = 6e-21 Identities = 51/73 (69%), Positives = 61/73 (83%) Frame = +2 Query: 53 MGVLDYISDRIDFSRSHSNKKLKKRKQLQTVEIKVRIDCEGCERKVKRSVEGMKGVTQVM 232 MGVLD++S+ D S H K+KKR+QLQTVEIKV++DCEGCERKV+RSVEGMKGV+ V Sbjct: 1 MGVLDHVSEMFDCSHGH---KIKKRRQLQTVEIKVKMDCEGCERKVRRSVEGMKGVSSVS 57 Query: 233 LEPKQHKLTVTGY 271 LEPK HK+TV GY Sbjct: 58 LEPKAHKVTVVGY 70 >ref|XP_013622814.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26 [Brassica oleracea var. oleracea] gi|923795679|ref|XP_013685718.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26-like [Brassica napus] Length = 153 Score = 106 bits (265), Expect = 6e-21 Identities = 51/73 (69%), Positives = 61/73 (83%) Frame = +2 Query: 53 MGVLDYISDRIDFSRSHSNKKLKKRKQLQTVEIKVRIDCEGCERKVKRSVEGMKGVTQVM 232 MGVLD++S+ D S H K+KKR+QLQTVEIKV++DCEGCERKV+RSVEGMKGV+ V Sbjct: 1 MGVLDHVSEMFDCSHGH---KIKKRRQLQTVEIKVKMDCEGCERKVRRSVEGMKGVSSVS 57 Query: 233 LEPKQHKLTVTGY 271 LEPK HK+TV GY Sbjct: 58 LEPKAHKVTVVGY 70 >ref|XP_009109542.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26 [Brassica rapa] gi|923691563|ref|XP_013656754.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26-like [Brassica napus] gi|674943233|emb|CDX90282.1| BnaA08g17020D [Brassica napus] Length = 153 Score = 106 bits (265), Expect = 6e-21 Identities = 51/73 (69%), Positives = 61/73 (83%) Frame = +2 Query: 53 MGVLDYISDRIDFSRSHSNKKLKKRKQLQTVEIKVRIDCEGCERKVKRSVEGMKGVTQVM 232 MGVLD++S+ D S H K+KKR+QLQTVEIKV++DCEGCERKV+RSVEGMKGV+ V Sbjct: 1 MGVLDHVSEMFDCSHGH---KIKKRRQLQTVEIKVKMDCEGCERKVRRSVEGMKGVSSVS 57 Query: 233 LEPKQHKLTVTGY 271 LEPK HK+TV GY Sbjct: 58 LEPKAHKVTVVGY 70 >ref|XP_009101937.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26 [Brassica rapa] gi|923652547|ref|XP_013644888.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26 [Brassica napus] gi|674869865|emb|CDY65011.1| BnaA06g40860D [Brassica napus] Length = 153 Score = 106 bits (265), Expect = 6e-21 Identities = 51/73 (69%), Positives = 61/73 (83%) Frame = +2 Query: 53 MGVLDYISDRIDFSRSHSNKKLKKRKQLQTVEIKVRIDCEGCERKVKRSVEGMKGVTQVM 232 MGVLD++S+ D S H K+KKR+QLQTVEIKV++DCEGCERKV+RSVEGMKGV+ V Sbjct: 1 MGVLDHVSEMFDCSHGH---KIKKRRQLQTVEIKVKMDCEGCERKVRRSVEGMKGVSSVS 57 Query: 233 LEPKQHKLTVTGY 271 LEPK HK+TV GY Sbjct: 58 LEPKAHKVTVVGY 70 >ref|XP_006411650.1| hypothetical protein EUTSA_v10026471mg [Eutrema salsugineum] gi|557112820|gb|ESQ53103.1| hypothetical protein EUTSA_v10026471mg [Eutrema salsugineum] Length = 153 Score = 106 bits (265), Expect = 6e-21 Identities = 51/73 (69%), Positives = 61/73 (83%) Frame = +2 Query: 53 MGVLDYISDRIDFSRSHSNKKLKKRKQLQTVEIKVRIDCEGCERKVKRSVEGMKGVTQVM 232 MGVLD++S+ D S H K+KKR+QLQTVEIKV++DCEGCERKV+RSVEGMKGV+ V Sbjct: 1 MGVLDHVSEMFDCSHGH---KIKKRRQLQTVEIKVKMDCEGCERKVRRSVEGMKGVSSVS 57 Query: 233 LEPKQHKLTVTGY 271 LEPK HK+TV GY Sbjct: 58 LEPKAHKVTVVGY 70 >ref|XP_007041823.1| Farnesylated protein 6 isoform 1 [Theobroma cacao] gi|508705758|gb|EOX97654.1| Farnesylated protein 6 isoform 1 [Theobroma cacao] Length = 154 Score = 106 bits (265), Expect = 6e-21 Identities = 55/73 (75%), Positives = 62/73 (84%) Frame = +2 Query: 53 MGVLDYISDRIDFSRSHSNKKLKKRKQLQTVEIKVRIDCEGCERKVKRSVEGMKGVTQVM 232 MG LD++SD D SRS S KLKKRKQLQTVEIKV++DCEGCERKVK+SVEGMKGVTQV Sbjct: 1 MGALDHVSDLFDCSRSSS--KLKKRKQLQTVEIKVKMDCEGCERKVKKSVEGMKGVTQVD 58 Query: 233 LEPKQHKLTVTGY 271 +E K +KLTV GY Sbjct: 59 VERKANKLTVVGY 71 >ref|XP_010531538.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26 [Tarenaya hassleriana] Length = 154 Score = 106 bits (264), Expect = 8e-21 Identities = 52/73 (71%), Positives = 62/73 (84%) Frame = +2 Query: 53 MGVLDYISDRIDFSRSHSNKKLKKRKQLQTVEIKVRIDCEGCERKVKRSVEGMKGVTQVM 232 MGVLD++SD D S H + K+KKRKQLQTVEIKV+IDCEGCERKV+RSVEGMKGV+ V Sbjct: 1 MGVLDHLSDVFDCS--HGSSKMKKRKQLQTVEIKVKIDCEGCERKVRRSVEGMKGVSSVT 58 Query: 233 LEPKQHKLTVTGY 271 +EPK +K+TV GY Sbjct: 59 VEPKANKVTVVGY 71 >ref|XP_010446365.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26 [Camelina sativa] Length = 153 Score = 106 bits (264), Expect = 8e-21 Identities = 51/73 (69%), Positives = 61/73 (83%) Frame = +2 Query: 53 MGVLDYISDRIDFSRSHSNKKLKKRKQLQTVEIKVRIDCEGCERKVKRSVEGMKGVTQVM 232 MGVLD++S+ D S H K+KKRKQLQ+VEIKV++DCEGCERKV+RSVEGMKGV+ V Sbjct: 1 MGVLDHVSEMFDCSHGH---KIKKRKQLQSVEIKVKMDCEGCERKVRRSVEGMKGVSSVT 57 Query: 233 LEPKQHKLTVTGY 271 LEPK HK+TV GY Sbjct: 58 LEPKAHKVTVVGY 70