BLASTX nr result
ID: Cornus23_contig00006967
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00006967 (539 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010662916.1| PREDICTED: uncharacterized protein LOC104882... 60 6e-07 ref|XP_007136494.1| hypothetical protein PHAVU_009G050000g [Phas... 60 6e-07 gb|KOM40648.1| hypothetical protein LR48_Vigan04g084600 [Vigna a... 57 7e-06 >ref|XP_010662916.1| PREDICTED: uncharacterized protein LOC104882244 [Vitis vinifera] Length = 33 Score = 60.1 bits (144), Expect = 6e-07 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -2 Query: 439 MSNIPRSLTDSSLSLFKLATSSSDPWPFSPVFL 341 MSN+PRSLTDSSL+LFKLA S+SDPWPFS VFL Sbjct: 1 MSNVPRSLTDSSLTLFKLAISASDPWPFSFVFL 33 >ref|XP_007136494.1| hypothetical protein PHAVU_009G050000g [Phaseolus vulgaris] gi|561009581|gb|ESW08488.1| hypothetical protein PHAVU_009G050000g [Phaseolus vulgaris] gi|947105208|gb|KRH53591.1| hypothetical protein GLYMA_06G134100 [Glycine max] gi|947116043|gb|KRH64345.1| hypothetical protein GLYMA_04G231200 [Glycine max] Length = 33 Score = 60.1 bits (144), Expect = 6e-07 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -2 Query: 439 MSNIPRSLTDSSLSLFKLATSSSDPWPFSPVFL 341 MSNIPRSLTDSSL+LF LA SSSDPWPFS VFL Sbjct: 1 MSNIPRSLTDSSLTLFNLAISSSDPWPFSLVFL 33 >gb|KOM40648.1| hypothetical protein LR48_Vigan04g084600 [Vigna angularis] Length = 175 Score = 56.6 bits (135), Expect = 7e-06 Identities = 30/47 (63%), Positives = 36/47 (76%), Gaps = 2/47 (4%) Frame = -2 Query: 439 MSNIPRSLTDSSLSLFKLATSSSDPWPFSPV--FL*PFQRNELERSR 305 MSNIPRSLTDSSL+LF LA SSSDPWPFS + FL P+ ++ S+ Sbjct: 1 MSNIPRSLTDSSLTLFNLAISSSDPWPFSLLRSFLSPYGDSQRSSSQ 47