BLASTX nr result
ID: Cornus23_contig00006798
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00006798 (266 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010241022.1| PREDICTED: anthocyanidin reductase [Nelumbo ... 76 9e-12 ref|XP_009785278.1| PREDICTED: anthocyanidin reductase [Nicotian... 76 1e-11 ref|XP_014507514.1| PREDICTED: anthocyanidin reductase-like [Vig... 75 3e-11 gb|AKE92923.1| anthocyanidin reductase, partial [Vaccinium uligi... 75 3e-11 dbj|BAM42668.1| anthocyanidin reductase [Vaccinium ashei] 75 3e-11 gb|AHJ11240.1| anthocyanidin reductase [Camellia sinensis] 74 6e-11 gb|ADZ58168.1| anthocyanidin reductase 1 [Camellia sinensis] 74 6e-11 gb|AJF94633.1| anthocyanidin reductase [Onobrychis viciifolia] 73 1e-10 ref|XP_009630487.1| PREDICTED: anthocyanidin reductase [Nicotian... 73 1e-10 gb|AGL81352.1| anthocyanidin reductase [Pyrus communis] 73 1e-10 gb|AEF14421.1| anthocyanidin reductase [Onobrychis viciifolia] 73 1e-10 gb|AEL79860.1| anthocyanidin reductase [Malus domestica] 73 1e-10 gb|ABB77695.1| anthocyanidin reductase [Pyrus communis] 73 1e-10 gb|AEJ35173.1| anthocyanidin reductase 2 [Camellia sinensis] 72 1e-10 ref|XP_007159213.1| hypothetical protein PHAVU_002G218700g [Phas... 72 2e-10 tpe|CAD91909.1| TPA: putative anthocyanidin reductase [Phaseolus... 72 2e-10 gb|ACN41348.1| anthocyanidin reductase-like protein [Vaccinium m... 71 3e-10 gb|AAZ79363.1| anthocyanidin reductase [Malus domestica] 71 3e-10 gb|AAX12184.1| putative anthocyanidin reductase [Malus domestica... 71 3e-10 ref|XP_006343275.1| PREDICTED: anthocyanidin reductase-like [Sol... 71 3e-10 >ref|XP_010241022.1| PREDICTED: anthocyanidin reductase [Nelumbo nucifera] Length = 339 Score = 76.3 bits (186), Expect = 9e-12 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = -3 Query: 264 PSKAKLIISSEKLIKEGFNFKYGIEEIYDQCVVYLKTKELLKN 136 P+KAKLI+SSEKLIKEGF+FKYGIEEIYDQCV Y KTK LL+N Sbjct: 297 PTKAKLILSSEKLIKEGFSFKYGIEEIYDQCVDYFKTKGLLQN 339 >ref|XP_009785278.1| PREDICTED: anthocyanidin reductase [Nicotiana sylvestris] Length = 329 Score = 75.9 bits (185), Expect = 1e-11 Identities = 37/43 (86%), Positives = 38/43 (88%) Frame = -3 Query: 264 PSKAKLIISSEKLIKEGFNFKYGIEEIYDQCVVYLKTKELLKN 136 PSKAKLIISSEKLIKEGFNFKYGIEEIYDQC+ K K LLKN Sbjct: 287 PSKAKLIISSEKLIKEGFNFKYGIEEIYDQCLACFKDKGLLKN 329 >ref|XP_014507514.1| PREDICTED: anthocyanidin reductase-like [Vigna radiata var. radiata] Length = 337 Score = 74.7 bits (182), Expect = 3e-11 Identities = 36/43 (83%), Positives = 39/43 (90%) Frame = -3 Query: 264 PSKAKLIISSEKLIKEGFNFKYGIEEIYDQCVVYLKTKELLKN 136 PSKAKLIISSEKL+KEGFNFKYGIEEIYDQ + YLK+K LKN Sbjct: 295 PSKAKLIISSEKLVKEGFNFKYGIEEIYDQTLEYLKSKGALKN 337 >gb|AKE92923.1| anthocyanidin reductase, partial [Vaccinium uliginosum] Length = 142 Score = 74.7 bits (182), Expect = 3e-11 Identities = 34/43 (79%), Positives = 40/43 (93%) Frame = -3 Query: 264 PSKAKLIISSEKLIKEGFNFKYGIEEIYDQCVVYLKTKELLKN 136 PSKAKLI+SSEKLIKEGF++KYGIEEIYDQCV Y K+K +L+N Sbjct: 100 PSKAKLIVSSEKLIKEGFSYKYGIEEIYDQCVEYFKSKGILQN 142 >dbj|BAM42668.1| anthocyanidin reductase [Vaccinium ashei] Length = 333 Score = 74.7 bits (182), Expect = 3e-11 Identities = 34/43 (79%), Positives = 40/43 (93%) Frame = -3 Query: 264 PSKAKLIISSEKLIKEGFNFKYGIEEIYDQCVVYLKTKELLKN 136 PSKAKLI+SSEKLIKEGF++KYGIEEIYDQCV Y K+K +L+N Sbjct: 291 PSKAKLIVSSEKLIKEGFSYKYGIEEIYDQCVEYFKSKGILQN 333 >gb|AHJ11240.1| anthocyanidin reductase [Camellia sinensis] Length = 347 Score = 73.6 bits (179), Expect = 6e-11 Identities = 36/43 (83%), Positives = 39/43 (90%) Frame = -3 Query: 264 PSKAKLIISSEKLIKEGFNFKYGIEEIYDQCVVYLKTKELLKN 136 PSKAKLIISSEKLIKEGF+FKYGIEEI+D V YLKTK LL+N Sbjct: 305 PSKAKLIISSEKLIKEGFSFKYGIEEIFDHSVAYLKTKGLLQN 347 >gb|ADZ58168.1| anthocyanidin reductase 1 [Camellia sinensis] Length = 347 Score = 73.6 bits (179), Expect = 6e-11 Identities = 36/43 (83%), Positives = 39/43 (90%) Frame = -3 Query: 264 PSKAKLIISSEKLIKEGFNFKYGIEEIYDQCVVYLKTKELLKN 136 PSKAKLIISSEKLIKEGF+FKYGIEEI+D V YLKTK LL+N Sbjct: 305 PSKAKLIISSEKLIKEGFSFKYGIEEIFDHSVAYLKTKGLLQN 347 >gb|AJF94633.1| anthocyanidin reductase [Onobrychis viciifolia] Length = 339 Score = 72.8 bits (177), Expect = 1e-10 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -3 Query: 264 PSKAKLIISSEKLIKEGFNFKYGIEEIYDQCVVYLKTKELLKN 136 P+KAKLI+SS+KLIKEGF+FKYGIEEIYDQ V YLKTK LKN Sbjct: 297 PAKAKLILSSDKLIKEGFSFKYGIEEIYDQTVEYLKTKGALKN 339 >ref|XP_009630487.1| PREDICTED: anthocyanidin reductase [Nicotiana tomentosiformis] Length = 329 Score = 72.8 bits (177), Expect = 1e-10 Identities = 36/43 (83%), Positives = 37/43 (86%) Frame = -3 Query: 264 PSKAKLIISSEKLIKEGFNFKYGIEEIYDQCVVYLKTKELLKN 136 PSKAKLIISSEKLIKEGFNFKY IEEIYDQC+ K K LLKN Sbjct: 287 PSKAKLIISSEKLIKEGFNFKYEIEEIYDQCLACFKDKGLLKN 329 >gb|AGL81352.1| anthocyanidin reductase [Pyrus communis] Length = 339 Score = 72.8 bits (177), Expect = 1e-10 Identities = 36/43 (83%), Positives = 38/43 (88%) Frame = -3 Query: 264 PSKAKLIISSEKLIKEGFNFKYGIEEIYDQCVVYLKTKELLKN 136 PSKAKLIISSEKLIKEGF+FKYGIEEIYDQ V Y K K LL+N Sbjct: 297 PSKAKLIISSEKLIKEGFDFKYGIEEIYDQTVEYFKAKGLLQN 339 >gb|AEF14421.1| anthocyanidin reductase [Onobrychis viciifolia] Length = 339 Score = 72.8 bits (177), Expect = 1e-10 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -3 Query: 264 PSKAKLIISSEKLIKEGFNFKYGIEEIYDQCVVYLKTKELLKN 136 P+KAKLI+SS+KLIKEGF+FKYGIEEIYDQ V YLKTK LKN Sbjct: 297 PAKAKLILSSDKLIKEGFSFKYGIEEIYDQTVEYLKTKGALKN 339 >gb|AEL79860.1| anthocyanidin reductase [Malus domestica] Length = 339 Score = 72.8 bits (177), Expect = 1e-10 Identities = 36/43 (83%), Positives = 38/43 (88%) Frame = -3 Query: 264 PSKAKLIISSEKLIKEGFNFKYGIEEIYDQCVVYLKTKELLKN 136 PSKAKLIISSEKLIKEGF+FKYGIEEIYDQ V Y K K LL+N Sbjct: 297 PSKAKLIISSEKLIKEGFDFKYGIEEIYDQTVEYFKAKGLLQN 339 >gb|ABB77695.1| anthocyanidin reductase [Pyrus communis] Length = 339 Score = 72.8 bits (177), Expect = 1e-10 Identities = 36/43 (83%), Positives = 38/43 (88%) Frame = -3 Query: 264 PSKAKLIISSEKLIKEGFNFKYGIEEIYDQCVVYLKTKELLKN 136 PSKAKLIISSEKLIKEGF+FKYGIEEIYDQ V Y K K LL+N Sbjct: 297 PSKAKLIISSEKLIKEGFDFKYGIEEIYDQTVEYFKAKGLLQN 339 >gb|AEJ35173.1| anthocyanidin reductase 2 [Camellia sinensis] Length = 347 Score = 72.4 bits (176), Expect = 1e-10 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -3 Query: 264 PSKAKLIISSEKLIKEGFNFKYGIEEIYDQCVVYLKTKELLKN 136 PSKAKLIISSEKLIKEGF+FKYGIEEI+D V YL+TK LL+N Sbjct: 305 PSKAKLIISSEKLIKEGFSFKYGIEEIFDHSVAYLRTKGLLQN 347 >ref|XP_007159213.1| hypothetical protein PHAVU_002G218700g [Phaseolus vulgaris] gi|561032628|gb|ESW31207.1| hypothetical protein PHAVU_002G218700g [Phaseolus vulgaris] Length = 337 Score = 72.0 bits (175), Expect = 2e-10 Identities = 35/43 (81%), Positives = 38/43 (88%) Frame = -3 Query: 264 PSKAKLIISSEKLIKEGFNFKYGIEEIYDQCVVYLKTKELLKN 136 PSKAKL ISSEKL+KEGF+FKYGIEEIYDQ V YLK+K LKN Sbjct: 295 PSKAKLTISSEKLVKEGFSFKYGIEEIYDQSVEYLKSKGALKN 337 >tpe|CAD91909.1| TPA: putative anthocyanidin reductase [Phaseolus coccineus] Length = 337 Score = 71.6 bits (174), Expect = 2e-10 Identities = 35/43 (81%), Positives = 37/43 (86%) Frame = -3 Query: 264 PSKAKLIISSEKLIKEGFNFKYGIEEIYDQCVVYLKTKELLKN 136 PSKAKL ISSEKL+KEGF+FKYGIEEIYDQ V YLK K LKN Sbjct: 295 PSKAKLTISSEKLVKEGFSFKYGIEEIYDQTVEYLKNKGTLKN 337 >gb|ACN41348.1| anthocyanidin reductase-like protein [Vaccinium myrtillus] Length = 164 Score = 71.2 bits (173), Expect = 3e-10 Identities = 33/43 (76%), Positives = 38/43 (88%) Frame = -3 Query: 264 PSKAKLIISSEKLIKEGFNFKYGIEEIYDQCVVYLKTKELLKN 136 PSKAKLI+S EKLIKEGF++KYGIEEIYDQCV Y K K +L+N Sbjct: 122 PSKAKLIVSFEKLIKEGFSYKYGIEEIYDQCVEYFKFKGILQN 164 >gb|AAZ79363.1| anthocyanidin reductase [Malus domestica] Length = 339 Score = 71.2 bits (173), Expect = 3e-10 Identities = 35/43 (81%), Positives = 38/43 (88%) Frame = -3 Query: 264 PSKAKLIISSEKLIKEGFNFKYGIEEIYDQCVVYLKTKELLKN 136 PS+AKLIISSEKLIKEGF+FKYGIEEIYDQ V Y K K LL+N Sbjct: 297 PSEAKLIISSEKLIKEGFDFKYGIEEIYDQTVEYFKAKGLLQN 339 >gb|AAX12184.1| putative anthocyanidin reductase [Malus domestica] gi|429489542|gb|AFZ93009.1| anthocyanidin reductase [Malus domestica] Length = 339 Score = 71.2 bits (173), Expect = 3e-10 Identities = 35/43 (81%), Positives = 38/43 (88%) Frame = -3 Query: 264 PSKAKLIISSEKLIKEGFNFKYGIEEIYDQCVVYLKTKELLKN 136 PS+AKLIISSEKLIKEGF+FKYGIEEIYDQ V Y K K LL+N Sbjct: 297 PSEAKLIISSEKLIKEGFDFKYGIEEIYDQTVEYFKAKGLLQN 339 >ref|XP_006343275.1| PREDICTED: anthocyanidin reductase-like [Solanum tuberosum] Length = 338 Score = 71.2 bits (173), Expect = 3e-10 Identities = 35/42 (83%), Positives = 36/42 (85%) Frame = -3 Query: 264 PSKAKLIISSEKLIKEGFNFKYGIEEIYDQCVVYLKTKELLK 139 PSKAKLIISSEKLIKEGF+FKYGIEEIYDQC K K LLK Sbjct: 296 PSKAKLIISSEKLIKEGFSFKYGIEEIYDQCAACFKDKGLLK 337