BLASTX nr result
ID: Cornus23_contig00006711
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00006711 (679 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004494525.1| PREDICTED: galactinol synthase 2-like [Cicer... 58 6e-06 >ref|XP_004494525.1| PREDICTED: galactinol synthase 2-like [Cicer arietinum] Length = 328 Score = 57.8 bits (138), Expect = 6e-06 Identities = 26/49 (53%), Positives = 29/49 (59%) Frame = +3 Query: 378 DLNAEKSWSDTKEYKLGYCQLSPDKVQGASKFKPKPAFYFKEEQKYRHP 524 D EK+WS T +YK+GYCQ PDKVQ S F PKP YF HP Sbjct: 147 DCFCEKTWSHTPQYKIGYCQQCPDKVQWPSDFGPKPPLYFNAGMFVFHP 195