BLASTX nr result
ID: Cornus23_contig00006255
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00006255 (819 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMS62068.1| DNA-directed RNA polymerase subunit alpha [Tritic... 69 5e-09 >gb|EMS62068.1| DNA-directed RNA polymerase subunit alpha [Triticum urartu] Length = 430 Score = 68.6 bits (166), Expect = 5e-09 Identities = 45/105 (42%), Positives = 59/105 (56%), Gaps = 2/105 (1%) Frame = +1 Query: 34 EFL*IHPPKEPDMIIFHHPARARIKRTKWIHIKSIC*KIYMLSISTHI*YMNGSM*EKNF 213 E IHPPKEPDM I+HHPARAR+K I + I +I + + S ++ +K+F Sbjct: 335 ELFRIHPPKEPDMRIYHHPARARVKE---IRPRKILNRIKVYNDSM-------TLGKKSF 384 Query: 214 TGFPFP--DLQLSIAKN*VLTGKYSIPK*AYKVDRNLIKCFLGRL 342 F FP LQL I N +L GK SI K AYK D + + C L + Sbjct: 385 IRFSFPKLHLQLLIENNPILMGKCSISKWAYKFDHDQLLCGLSHV 429