BLASTX nr result
ID: Cornus23_contig00006107
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00006107 (330 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012077649.1| PREDICTED: small acidic protein 1 [Jatropha ... 60 6e-07 ref|XP_002314520.1| hypothetical protein POPTR_0010s07360g [Popu... 57 5e-06 ref|XP_006493997.1| PREDICTED: small acidic protein 1-like [Citr... 57 5e-06 gb|KDP33354.1| hypothetical protein JCGZ_12903 [Jatropha curcas] 56 9e-06 >ref|XP_012077649.1| PREDICTED: small acidic protein 1 [Jatropha curcas] Length = 62 Score = 60.1 bits (144), Expect = 6e-07 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -2 Query: 329 ADLEEQGSTMAMDVDDVDSLEIFGEGLITIDHKL 228 AD+EEQGSTMAM+VDDVD LEIFGEG+I ID+KL Sbjct: 10 ADMEEQGSTMAMEVDDVDPLEIFGEGVINIDNKL 43 >ref|XP_002314520.1| hypothetical protein POPTR_0010s07360g [Populus trichocarpa] gi|222863560|gb|EEF00691.1| hypothetical protein POPTR_0010s07360g [Populus trichocarpa] Length = 62 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/34 (73%), Positives = 33/34 (97%) Frame = -2 Query: 329 ADLEEQGSTMAMDVDDVDSLEIFGEGLITIDHKL 228 AD+EEQGST+AMDVDDVD+LE+FGEG+I +++KL Sbjct: 10 ADMEEQGSTVAMDVDDVDTLEMFGEGVINMENKL 43 >ref|XP_006493997.1| PREDICTED: small acidic protein 1-like [Citrus sinensis] Length = 62 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/33 (75%), Positives = 32/33 (96%) Frame = -2 Query: 326 DLEEQGSTMAMDVDDVDSLEIFGEGLITIDHKL 228 D+E+QG+T+AMDVDDVD LEIFGEG+I+ID+KL Sbjct: 11 DMEDQGATVAMDVDDVDPLEIFGEGIISIDNKL 43 >gb|KDP33354.1| hypothetical protein JCGZ_12903 [Jatropha curcas] Length = 51 Score = 56.2 bits (134), Expect = 9e-06 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -2 Query: 323 LEEQGSTMAMDVDDVDSLEIFGEGLITIDHKL 228 +EEQGSTMAM+VDDVD LEIFGEG+I ID+KL Sbjct: 1 MEEQGSTMAMEVDDVDPLEIFGEGVINIDNKL 32