BLASTX nr result
ID: Cornus23_contig00004803
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00004803 (2331 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008391159.1| PREDICTED: uncharacterized protein LOC103453... 42 3e-06 >ref|XP_008391159.1| PREDICTED: uncharacterized protein LOC103453396 [Malus domestica] Length = 1219 Score = 42.0 bits (97), Expect(2) = 3e-06 Identities = 16/32 (50%), Positives = 26/32 (81%) Frame = -3 Query: 910 YIASAVGEPLYADEATETRTKLRFVRICINLD 815 +IASAVG+PL+ D TE++ ++ F+RIC+ +D Sbjct: 379 HIASAVGKPLHVDSLTESKKRISFMRICVEVD 410 Score = 39.3 bits (90), Expect(2) = 3e-06 Identities = 16/30 (53%), Positives = 19/30 (63%) Frame = -1 Query: 756 VVLRVEYQWLPKFCLKCKAFNHSEANCPAT 667 V + VEYQ P+ CL CK F H E+ CP T Sbjct: 435 VEVNVEYQCRPRLCLHCKTFGHYESACPHT 464