BLASTX nr result
ID: Cornus23_contig00004585
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00004585 (577 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010246114.1| PREDICTED: pentatricopeptide repeat-containi... 60 8e-07 >ref|XP_010246114.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19191, mitochondrial-like [Nelumbo nucifera] Length = 719 Score = 60.1 bits (144), Expect = 8e-07 Identities = 29/39 (74%), Positives = 32/39 (82%) Frame = -1 Query: 547 TAIAVVSSIADLKSFCQGKQIHALVIRNGLDYQVSVQKS 431 TAIAVV S+A+LKS C GKQIHA VIRNG DYQ+SV S Sbjct: 330 TAIAVVPSVAELKSLCHGKQIHANVIRNGSDYQISVHNS 368