BLASTX nr result
ID: Cornus23_contig00004557
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00004557 (386 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009768825.1| PREDICTED: meiotic recombination protein SPO... 60 4e-14 ref|XP_009768827.1| PREDICTED: meiotic recombination protein SPO... 60 4e-14 ref|XP_009768830.1| PREDICTED: meiotic recombination protein SPO... 60 4e-14 ref|XP_011029357.1| PREDICTED: meiotic recombination protein SPO... 56 1e-13 ref|XP_011029358.1| PREDICTED: meiotic recombination protein SPO... 56 1e-13 ref|XP_011029359.1| PREDICTED: meiotic recombination protein SPO... 56 1e-13 ref|XP_006368767.1| hypothetical protein POPTR_0001s09890g [Popu... 56 1e-13 ref|XP_004511556.1| PREDICTED: meiotic recombination protein SPO... 54 2e-13 ref|XP_012574473.1| PREDICTED: meiotic recombination protein SPO... 54 2e-13 ref|XP_009590057.1| PREDICTED: meiotic recombination protein SPO... 56 3e-13 ref|XP_008238957.1| PREDICTED: meiotic recombination protein SPO... 56 3e-13 ref|XP_007208791.1| hypothetical protein PRUPE_ppa024198mg [Prun... 56 3e-13 ref|XP_010658382.1| PREDICTED: meiotic recombination protein SPO... 56 3e-13 emb|CBI34392.3| unnamed protein product [Vitis vinifera] 56 3e-13 ref|XP_009590058.1| PREDICTED: meiotic recombination protein SPO... 56 3e-13 ref|XP_006344018.1| PREDICTED: meiotic recombination protein SPO... 56 3e-13 ref|XP_006476492.1| PREDICTED: meiotic recombination protein SPO... 55 4e-13 ref|XP_006476493.1| PREDICTED: meiotic recombination protein SPO... 55 4e-13 ref|XP_006439466.1| hypothetical protein CICLE_v10024616mg [Citr... 55 4e-13 ref|XP_003611060.2| meiotic recombination SPO11-like protein [Me... 54 4e-13 >ref|XP_009768825.1| PREDICTED: meiotic recombination protein SPO11-2 isoform X1 [Nicotiana sylvestris] Length = 410 Score = 60.1 bits (144), Expect(2) = 4e-14 Identities = 29/31 (93%), Positives = 30/31 (96%), Gaps = 1/31 (3%) Frame = +3 Query: 201 NPAGLAILCTFKFGSIGMGLEAYRYGA-FSF 290 NPAGLAILCTFKFGSIGMGLEAYRYGA FS+ Sbjct: 270 NPAGLAILCTFKFGSIGMGLEAYRYGARFSY 300 Score = 44.3 bits (103), Expect(2) = 4e-14 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = +1 Query: 43 ANRFLLHRMSRAFPELPILGLVDW 114 A RFLLHR+ RAFP LP+LG VDW Sbjct: 246 ATRFLLHRICRAFPNLPVLGFVDW 269 >ref|XP_009768827.1| PREDICTED: meiotic recombination protein SPO11-2 isoform X2 [Nicotiana sylvestris] Length = 409 Score = 60.1 bits (144), Expect(2) = 4e-14 Identities = 29/31 (93%), Positives = 30/31 (96%), Gaps = 1/31 (3%) Frame = +3 Query: 201 NPAGLAILCTFKFGSIGMGLEAYRYGA-FSF 290 NPAGLAILCTFKFGSIGMGLEAYRYGA FS+ Sbjct: 270 NPAGLAILCTFKFGSIGMGLEAYRYGARFSY 300 Score = 44.3 bits (103), Expect(2) = 4e-14 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = +1 Query: 43 ANRFLLHRMSRAFPELPILGLVDW 114 A RFLLHR+ RAFP LP+LG VDW Sbjct: 246 ATRFLLHRICRAFPNLPVLGFVDW 269 >ref|XP_009768830.1| PREDICTED: meiotic recombination protein SPO11-2 isoform X5 [Nicotiana sylvestris] Length = 309 Score = 60.1 bits (144), Expect(2) = 4e-14 Identities = 29/31 (93%), Positives = 30/31 (96%), Gaps = 1/31 (3%) Frame = +3 Query: 201 NPAGLAILCTFKFGSIGMGLEAYRYGA-FSF 290 NPAGLAILCTFKFGSIGMGLEAYRYGA FS+ Sbjct: 169 NPAGLAILCTFKFGSIGMGLEAYRYGARFSY 199 Score = 44.3 bits (103), Expect(2) = 4e-14 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = +1 Query: 43 ANRFLLHRMSRAFPELPILGLVDW 114 A RFLLHR+ RAFP LP+LG VDW Sbjct: 145 ATRFLLHRICRAFPNLPVLGFVDW 168 >ref|XP_011029357.1| PREDICTED: meiotic recombination protein SPO11-2 isoform X1 [Populus euphratica] Length = 380 Score = 55.8 bits (133), Expect(2) = 1e-13 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 201 NPAGLAILCTFKFGSIGMGLEAYRY 275 NPAGLAILCTFKFGSIGMGLEAYRY Sbjct: 269 NPAGLAILCTFKFGSIGMGLEAYRY 293 Score = 47.0 bits (110), Expect(2) = 1e-13 Identities = 20/24 (83%), Positives = 21/24 (87%) Frame = +1 Query: 43 ANRFLLHRMSRAFPELPILGLVDW 114 A RFLLHRMSR FPELPI+ LVDW Sbjct: 245 ATRFLLHRMSRTFPELPIMALVDW 268 >ref|XP_011029358.1| PREDICTED: meiotic recombination protein SPO11-2 isoform X2 [Populus euphratica] Length = 377 Score = 55.8 bits (133), Expect(2) = 1e-13 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 201 NPAGLAILCTFKFGSIGMGLEAYRY 275 NPAGLAILCTFKFGSIGMGLEAYRY Sbjct: 266 NPAGLAILCTFKFGSIGMGLEAYRY 290 Score = 47.0 bits (110), Expect(2) = 1e-13 Identities = 20/24 (83%), Positives = 21/24 (87%) Frame = +1 Query: 43 ANRFLLHRMSRAFPELPILGLVDW 114 A RFLLHRMSR FPELPI+ LVDW Sbjct: 242 ATRFLLHRMSRTFPELPIMALVDW 265 >ref|XP_011029359.1| PREDICTED: meiotic recombination protein SPO11-2 isoform X3 [Populus euphratica] Length = 375 Score = 55.8 bits (133), Expect(2) = 1e-13 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 201 NPAGLAILCTFKFGSIGMGLEAYRY 275 NPAGLAILCTFKFGSIGMGLEAYRY Sbjct: 264 NPAGLAILCTFKFGSIGMGLEAYRY 288 Score = 47.0 bits (110), Expect(2) = 1e-13 Identities = 20/24 (83%), Positives = 21/24 (87%) Frame = +1 Query: 43 ANRFLLHRMSRAFPELPILGLVDW 114 A RFLLHRMSR FPELPI+ LVDW Sbjct: 240 ATRFLLHRMSRTFPELPIMALVDW 263 >ref|XP_006368767.1| hypothetical protein POPTR_0001s09890g [Populus trichocarpa] gi|550346922|gb|ERP65336.1| hypothetical protein POPTR_0001s09890g [Populus trichocarpa] Length = 331 Score = 55.8 bits (133), Expect(2) = 1e-13 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 201 NPAGLAILCTFKFGSIGMGLEAYRY 275 NPAGLAILCTFKFGSIGMGLEAYRY Sbjct: 220 NPAGLAILCTFKFGSIGMGLEAYRY 244 Score = 47.0 bits (110), Expect(2) = 1e-13 Identities = 20/24 (83%), Positives = 21/24 (87%) Frame = +1 Query: 43 ANRFLLHRMSRAFPELPILGLVDW 114 A RFLLHRMSR FPELPI+ LVDW Sbjct: 196 ATRFLLHRMSRTFPELPIMALVDW 219 >ref|XP_004511556.1| PREDICTED: meiotic recombination protein SPO11-2 isoform X1 [Cicer arietinum] Length = 383 Score = 54.3 bits (129), Expect(2) = 2e-13 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = +3 Query: 201 NPAGLAILCTFKFGSIGMGLEAYRY 275 NPAGLAILCTFKFGS+GMGLE+YRY Sbjct: 272 NPAGLAILCTFKFGSVGMGLESYRY 296 Score = 47.8 bits (112), Expect(2) = 2e-13 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = +1 Query: 43 ANRFLLHRMSRAFPELPILGLVDW 114 A RFLLHR+SRAFPELPIL LVDW Sbjct: 248 ATRFLLHRISRAFPELPILALVDW 271 >ref|XP_012574473.1| PREDICTED: meiotic recombination protein SPO11-2 isoform X2 [Cicer arietinum] Length = 344 Score = 54.3 bits (129), Expect(2) = 2e-13 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = +3 Query: 201 NPAGLAILCTFKFGSIGMGLEAYRY 275 NPAGLAILCTFKFGS+GMGLE+YRY Sbjct: 272 NPAGLAILCTFKFGSVGMGLESYRY 296 Score = 47.8 bits (112), Expect(2) = 2e-13 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = +1 Query: 43 ANRFLLHRMSRAFPELPILGLVDW 114 A RFLLHR+SRAFPELPIL LVDW Sbjct: 248 ATRFLLHRISRAFPELPILALVDW 271 >ref|XP_009590057.1| PREDICTED: meiotic recombination protein SPO11-2 isoform X1 [Nicotiana tomentosiformis] Length = 382 Score = 55.8 bits (133), Expect(2) = 3e-13 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 201 NPAGLAILCTFKFGSIGMGLEAYRY 275 NPAGLAILCTFKFGSIGMGLEAYRY Sbjct: 270 NPAGLAILCTFKFGSIGMGLEAYRY 294 Score = 45.8 bits (107), Expect(2) = 3e-13 Identities = 19/24 (79%), Positives = 20/24 (83%) Frame = +1 Query: 43 ANRFLLHRMSRAFPELPILGLVDW 114 A RFLLHRM R FP LP+LGLVDW Sbjct: 246 ATRFLLHRMCRTFPNLPVLGLVDW 269 >ref|XP_008238957.1| PREDICTED: meiotic recombination protein SPO11-2 [Prunus mume] Length = 382 Score = 55.8 bits (133), Expect(2) = 3e-13 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 201 NPAGLAILCTFKFGSIGMGLEAYRY 275 NPAGLAILCTFKFGSIGMGLEAYRY Sbjct: 271 NPAGLAILCTFKFGSIGMGLEAYRY 295 Score = 45.8 bits (107), Expect(2) = 3e-13 Identities = 20/24 (83%), Positives = 21/24 (87%) Frame = +1 Query: 43 ANRFLLHRMSRAFPELPILGLVDW 114 A R LLHRMSRAFP+LPIL LVDW Sbjct: 247 ATRLLLHRMSRAFPDLPILALVDW 270 >ref|XP_007208791.1| hypothetical protein PRUPE_ppa024198mg [Prunus persica] gi|462404526|gb|EMJ09990.1| hypothetical protein PRUPE_ppa024198mg [Prunus persica] Length = 382 Score = 55.8 bits (133), Expect(2) = 3e-13 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 201 NPAGLAILCTFKFGSIGMGLEAYRY 275 NPAGLAILCTFKFGSIGMGLEAYRY Sbjct: 271 NPAGLAILCTFKFGSIGMGLEAYRY 295 Score = 45.8 bits (107), Expect(2) = 3e-13 Identities = 20/24 (83%), Positives = 21/24 (87%) Frame = +1 Query: 43 ANRFLLHRMSRAFPELPILGLVDW 114 A R LLHRMSRAFP+LPIL LVDW Sbjct: 247 ATRLLLHRMSRAFPDLPILALVDW 270 >ref|XP_010658382.1| PREDICTED: meiotic recombination protein SPO11-2 [Vitis vinifera] Length = 381 Score = 55.8 bits (133), Expect(2) = 3e-13 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 201 NPAGLAILCTFKFGSIGMGLEAYRY 275 NPAGLAILCTFKFGSIGMGLEAYRY Sbjct: 270 NPAGLAILCTFKFGSIGMGLEAYRY 294 Score = 45.8 bits (107), Expect(2) = 3e-13 Identities = 20/24 (83%), Positives = 22/24 (91%) Frame = +1 Query: 43 ANRFLLHRMSRAFPELPILGLVDW 114 A RFLL+RMSRAFP+LPIL LVDW Sbjct: 246 ATRFLLYRMSRAFPDLPILALVDW 269 >emb|CBI34392.3| unnamed protein product [Vitis vinifera] Length = 381 Score = 55.8 bits (133), Expect(2) = 3e-13 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 201 NPAGLAILCTFKFGSIGMGLEAYRY 275 NPAGLAILCTFKFGSIGMGLEAYRY Sbjct: 270 NPAGLAILCTFKFGSIGMGLEAYRY 294 Score = 45.8 bits (107), Expect(2) = 3e-13 Identities = 20/24 (83%), Positives = 22/24 (91%) Frame = +1 Query: 43 ANRFLLHRMSRAFPELPILGLVDW 114 A RFLL+RMSRAFP+LPIL LVDW Sbjct: 246 ATRFLLYRMSRAFPDLPILALVDW 269 >ref|XP_009590058.1| PREDICTED: meiotic recombination protein SPO11-2 isoform X2 [Nicotiana tomentosiformis] Length = 363 Score = 55.8 bits (133), Expect(2) = 3e-13 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 201 NPAGLAILCTFKFGSIGMGLEAYRY 275 NPAGLAILCTFKFGSIGMGLEAYRY Sbjct: 270 NPAGLAILCTFKFGSIGMGLEAYRY 294 Score = 45.8 bits (107), Expect(2) = 3e-13 Identities = 19/24 (79%), Positives = 20/24 (83%) Frame = +1 Query: 43 ANRFLLHRMSRAFPELPILGLVDW 114 A RFLLHRM R FP LP+LGLVDW Sbjct: 246 ATRFLLHRMCRTFPNLPVLGLVDW 269 >ref|XP_006344018.1| PREDICTED: meiotic recombination protein SPO11-2-like [Solanum tuberosum] Length = 382 Score = 55.8 bits (133), Expect(2) = 3e-13 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 201 NPAGLAILCTFKFGSIGMGLEAYRY 275 NPAGLAILCTFKFGSIGMGLEAYRY Sbjct: 270 NPAGLAILCTFKFGSIGMGLEAYRY 294 Score = 45.4 bits (106), Expect(2) = 3e-13 Identities = 19/24 (79%), Positives = 20/24 (83%) Frame = +1 Query: 43 ANRFLLHRMSRAFPELPILGLVDW 114 A RFLLHRM R FP LP+LGLVDW Sbjct: 246 ATRFLLHRMCRMFPNLPVLGLVDW 269 >ref|XP_006476492.1| PREDICTED: meiotic recombination protein SPO11-2-like isoform X1 [Citrus sinensis] Length = 386 Score = 55.1 bits (131), Expect(2) = 4e-13 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +3 Query: 201 NPAGLAILCTFKFGSIGMGLEAYRY 275 NPAGLAILCTFKFGSIGMG+EAYRY Sbjct: 275 NPAGLAILCTFKFGSIGMGMEAYRY 299 Score = 45.8 bits (107), Expect(2) = 4e-13 Identities = 19/24 (79%), Positives = 22/24 (91%) Frame = +1 Query: 43 ANRFLLHRMSRAFPELPILGLVDW 114 A RFLLHR++RAFP+LPIL LVDW Sbjct: 251 ATRFLLHRLNRAFPDLPILALVDW 274 >ref|XP_006476493.1| PREDICTED: meiotic recombination protein SPO11-2-like isoform X2 [Citrus sinensis] Length = 382 Score = 55.1 bits (131), Expect(2) = 4e-13 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +3 Query: 201 NPAGLAILCTFKFGSIGMGLEAYRY 275 NPAGLAILCTFKFGSIGMG+EAYRY Sbjct: 271 NPAGLAILCTFKFGSIGMGMEAYRY 295 Score = 45.8 bits (107), Expect(2) = 4e-13 Identities = 19/24 (79%), Positives = 22/24 (91%) Frame = +1 Query: 43 ANRFLLHRMSRAFPELPILGLVDW 114 A RFLLHR++RAFP+LPIL LVDW Sbjct: 247 ATRFLLHRLNRAFPDLPILALVDW 270 >ref|XP_006439466.1| hypothetical protein CICLE_v10024616mg [Citrus clementina] gi|557541728|gb|ESR52706.1| hypothetical protein CICLE_v10024616mg [Citrus clementina] Length = 382 Score = 55.1 bits (131), Expect(2) = 4e-13 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +3 Query: 201 NPAGLAILCTFKFGSIGMGLEAYRY 275 NPAGLAILCTFKFGSIGMG+EAYRY Sbjct: 271 NPAGLAILCTFKFGSIGMGMEAYRY 295 Score = 45.8 bits (107), Expect(2) = 4e-13 Identities = 19/24 (79%), Positives = 22/24 (91%) Frame = +1 Query: 43 ANRFLLHRMSRAFPELPILGLVDW 114 A RFLLHR++RAFP+LPIL LVDW Sbjct: 247 ATRFLLHRLNRAFPDLPILALVDW 270 >ref|XP_003611060.2| meiotic recombination SPO11-like protein [Medicago truncatula] gi|657383826|gb|AES94018.2| meiotic recombination SPO11-like protein [Medicago truncatula] Length = 382 Score = 54.3 bits (129), Expect(2) = 4e-13 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = +3 Query: 201 NPAGLAILCTFKFGSIGMGLEAYRY 275 NPAGLAILCTFKFGS+GMGLE+YRY Sbjct: 271 NPAGLAILCTFKFGSVGMGLESYRY 295 Score = 46.6 bits (109), Expect(2) = 4e-13 Identities = 20/24 (83%), Positives = 22/24 (91%) Frame = +1 Query: 43 ANRFLLHRMSRAFPELPILGLVDW 114 A RFLLHR+SRAFP+LPIL LVDW Sbjct: 247 ATRFLLHRISRAFPDLPILALVDW 270