BLASTX nr result
ID: Cornus23_contig00004460
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00004460 (632 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KNG47540.1| glyoxalase family protein [Stemphylium lycopersici] 62 3e-07 ref|XP_003841723.1| predicted protein [Leptosphaeria maculans JN... 62 3e-07 >gb|KNG47540.1| glyoxalase family protein [Stemphylium lycopersici] Length = 755 Score = 62.0 bits (149), Expect = 3e-07 Identities = 32/53 (60%), Positives = 40/53 (75%) Frame = -1 Query: 560 AHSVAPSTLISSFVPDHAPRRSSEGSVASHQSNRSKAKSSHTQTSRHTAQSKQ 402 AHS APSTL+SSFV D+ +SS GS SH+S+RSKAKSSH S+HT+ K+ Sbjct: 442 AHSAAPSTLVSSFVADYDDMKSSAGSERSHRSSRSKAKSSH---SKHTSSRKE 491 >ref|XP_003841723.1| predicted protein [Leptosphaeria maculans JN3] gi|312218298|emb|CBX98244.1| predicted protein [Leptosphaeria maculans JN3] Length = 757 Score = 62.0 bits (149), Expect = 3e-07 Identities = 30/52 (57%), Positives = 39/52 (75%) Frame = -1 Query: 560 AHSVAPSTLISSFVPDHAPRRSSEGSVASHQSNRSKAKSSHTQTSRHTAQSK 405 A SVAPSTLISSFVPD RRSS GS+ S+ S +SK KS+ + +S+H++ K Sbjct: 463 AQSVAPSTLISSFVPDQVERRSSAGSIQSYHSTQSKTKSTASHSSKHSSHPK 514