BLASTX nr result
ID: Cornus23_contig00003704
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00003704 (618 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACU13202.1| unknown [Glycine max] 58 4e-06 >gb|ACU13202.1| unknown [Glycine max] Length = 105 Score = 58.2 bits (139), Expect = 4e-06 Identities = 32/59 (54%), Positives = 35/59 (59%) Frame = +3 Query: 294 HRPQMPPVLPSSQPFLEALSHLFHGVVQGSTHRLCSYPYHRSEPLLFRDHGPSDYRESL 470 H + PV S P A SHLF VQGSTH L + YHR +P FRDH PS YRESL Sbjct: 24 HYSLLHPVPLSLPPSPAAPSHLFPCAVQGSTHHLSACLYHRFQPEPFRDHDPSGYRESL 82