BLASTX nr result
ID: Cornus23_contig00003301
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00003301 (518 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74398.1| hypothetical protein M569_00361, partial [Genlise... 76 1e-11 ref|YP_001152105.1| ORF66a [Pinus koraiensis] gi|145048732|gb|AB... 57 7e-06 >gb|EPS74398.1| hypothetical protein M569_00361, partial [Genlisea aurea] Length = 56 Score = 75.9 bits (185), Expect = 1e-11 Identities = 38/55 (69%), Positives = 44/55 (80%) Frame = +3 Query: 153 RDVAQLGSAFVLGTKCHGFKSCHPYLLLLL*AVTKDQLRLIQIGHT*SFIFMILY 317 RDVAQLGSAFVLGTKCHGFKSCHPYLLLL AV+++++R I+I T F I Y Sbjct: 1 RDVAQLGSAFVLGTKCHGFKSCHPYLLLLKRAVSQNKVRSIEIARTPYFYETIEY 55 >ref|YP_001152105.1| ORF66a [Pinus koraiensis] gi|145048732|gb|ABP35351.1| ORF66a [Pinus koraiensis] Length = 66 Score = 56.6 bits (135), Expect = 7e-06 Identities = 31/47 (65%), Positives = 32/47 (68%), Gaps = 2/47 (4%) Frame = +3 Query: 153 RDVAQLGSAFVLGTKCHGFKSCHPYLLLLL*AV--TKDQLRLIQIGH 287 RDVAQLGS FVLGTKC FKSCHPYL LL TKD L I+ H Sbjct: 4 RDVAQLGSVFVLGTKCRRFKSCHPYLSLLFYGKKGTKDHLISIRREH 50