BLASTX nr result
ID: Cornus23_contig00003229
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00003229 (354 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010684190.1| PREDICTED: plasma membrane-associated cation... 67 7e-09 gb|AFK47427.1| unknown [Lotus japonicus] 67 7e-09 gb|AFK34640.1| unknown [Lotus japonicus] 67 7e-09 gb|KDO77173.1| hypothetical protein CISIN_1g027915mg [Citrus sin... 65 2e-08 gb|KDO77172.1| hypothetical protein CISIN_1g027915mg [Citrus sin... 65 2e-08 ref|XP_006468602.1| PREDICTED: plasma membrane-associated cation... 65 2e-08 ref|XP_004248413.1| PREDICTED: plasma membrane-associated cation... 64 3e-08 emb|CAA65195.1| 22 kDa polypeptide [Nicotiana tabacum] gi|780113... 64 6e-08 ref|XP_009763203.1| PREDICTED: plasma membrane-associated cation... 64 6e-08 ref|XP_009763202.1| PREDICTED: plasma membrane-associated cation... 64 6e-08 ref|XP_009763200.1| PREDICTED: plasma membrane-associated cation... 64 6e-08 ref|XP_009600401.1| PREDICTED: plasma membrane-associated cation... 64 6e-08 ref|XP_009600368.1| PREDICTED: plasma membrane-associated cation... 64 6e-08 ref|XP_002532713.1| endomembrane-associated protein, putative [R... 64 6e-08 ref|XP_006448567.1| hypothetical protein CICLE_v10016618mg [Citr... 64 6e-08 ref|XP_006448565.1| hypothetical protein CICLE_v10016618mg [Citr... 64 6e-08 ref|XP_009620274.1| PREDICTED: plasma membrane-associated cation... 63 7e-08 ref|XP_009368571.1| PREDICTED: plasma membrane-associated cation... 63 7e-08 ref|XP_010051796.1| PREDICTED: plasma membrane-associated cation... 63 7e-08 ref|XP_009764366.1| PREDICTED: plasma membrane-associated cation... 63 7e-08 >ref|XP_010684190.1| PREDICTED: plasma membrane-associated cation-binding protein 1 [Beta vulgaris subsp. vulgaris] gi|870854416|gb|KMT06194.1| hypothetical protein BVRB_7g162650 [Beta vulgaris subsp. vulgaris] Length = 206 Score = 66.6 bits (161), Expect = 7e-09 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +2 Query: 2 EFPGSKPVREASSKFGPSSVPGPIIFVFEKVSTFIVT 112 EFPGSK V EASSKFGP+ +PGP+IFVFEKVSTFIVT Sbjct: 96 EFPGSKAVCEASSKFGPALIPGPVIFVFEKVSTFIVT 132 >gb|AFK47427.1| unknown [Lotus japonicus] Length = 223 Score = 66.6 bits (161), Expect = 7e-09 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +2 Query: 2 EFPGSKPVREASSKFGPSSVPGPIIFVFEKVSTFIVT 112 EFPGSK V EASSKFGP+ VPGP++FVFEKVSTFIVT Sbjct: 96 EFPGSKVVSEASSKFGPALVPGPVLFVFEKVSTFIVT 132 >gb|AFK34640.1| unknown [Lotus japonicus] Length = 223 Score = 66.6 bits (161), Expect = 7e-09 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +2 Query: 2 EFPGSKPVREASSKFGPSSVPGPIIFVFEKVSTFIVT 112 EFPGSK V EASSKFGP+ VPGP++FVFEKVSTFIVT Sbjct: 96 EFPGSKVVSEASSKFGPALVPGPVLFVFEKVSTFIVT 132 >gb|KDO77173.1| hypothetical protein CISIN_1g027915mg [Citrus sinensis] Length = 129 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = +2 Query: 2 EFPGSKPVREASSKFGPSSVPGPIIFVFEKVSTFIVT 112 EFPGSK V EASSKFG +SVPGP+ F+FEKVSTFIVT Sbjct: 8 EFPGSKAVSEASSKFGAASVPGPVFFIFEKVSTFIVT 44 >gb|KDO77172.1| hypothetical protein CISIN_1g027915mg [Citrus sinensis] Length = 154 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = +2 Query: 2 EFPGSKPVREASSKFGPSSVPGPIIFVFEKVSTFIVT 112 EFPGSK V EASSKFG +SVPGP+ F+FEKVSTFIVT Sbjct: 33 EFPGSKAVSEASSKFGAASVPGPVFFIFEKVSTFIVT 69 >ref|XP_006468602.1| PREDICTED: plasma membrane-associated cation-binding protein 1-like isoform X1 [Citrus sinensis] gi|568828545|ref|XP_006468603.1| PREDICTED: plasma membrane-associated cation-binding protein 1-like isoform X2 [Citrus sinensis] gi|641858447|gb|KDO77169.1| hypothetical protein CISIN_1g027915mg [Citrus sinensis] gi|641858448|gb|KDO77170.1| hypothetical protein CISIN_1g027915mg [Citrus sinensis] gi|641858449|gb|KDO77171.1| hypothetical protein CISIN_1g027915mg [Citrus sinensis] Length = 217 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = +2 Query: 2 EFPGSKPVREASSKFGPSSVPGPIIFVFEKVSTFIVT 112 EFPGSK V EASSKFG +SVPGP+ F+FEKVSTFIVT Sbjct: 96 EFPGSKAVSEASSKFGAASVPGPVFFIFEKVSTFIVT 132 >ref|XP_004248413.1| PREDICTED: plasma membrane-associated cation-binding protein 1 [Solanum lycopersicum] Length = 201 Score = 64.3 bits (155), Expect = 3e-08 Identities = 32/37 (86%), Positives = 32/37 (86%) Frame = +2 Query: 2 EFPGSKPVREASSKFGPSSVPGPIIFVFEKVSTFIVT 112 EFPGSK V EASS FGPS V GPIIFVFEKVSTFIVT Sbjct: 96 EFPGSKAVSEASSNFGPSYVSGPIIFVFEKVSTFIVT 132 >emb|CAA65195.1| 22 kDa polypeptide [Nicotiana tabacum] gi|7801133|emb|CAB91553.1| DREPP4 protein [Nicotiana tabacum] Length = 197 Score = 63.5 bits (153), Expect = 6e-08 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = +2 Query: 2 EFPGSKPVREASSKFGPSSVPGPIIFVFEKVSTFIVT 112 EFPGSK V EASSKFGPS V GPIIFV EKVSTF+VT Sbjct: 96 EFPGSKAVSEASSKFGPSYVSGPIIFVLEKVSTFVVT 132 >ref|XP_009763203.1| PREDICTED: plasma membrane-associated cation-binding protein 1-like isoform X3 [Nicotiana sylvestris] Length = 201 Score = 63.5 bits (153), Expect = 6e-08 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = +2 Query: 2 EFPGSKPVREASSKFGPSSVPGPIIFVFEKVSTFIVT 112 EFPGSK V EASSKFGPS V GPIIFV EKVSTF+VT Sbjct: 96 EFPGSKAVSEASSKFGPSYVSGPIIFVLEKVSTFVVT 132 >ref|XP_009763202.1| PREDICTED: plasma membrane-associated cation-binding protein 1-like isoform X2 [Nicotiana sylvestris] Length = 203 Score = 63.5 bits (153), Expect = 6e-08 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = +2 Query: 2 EFPGSKPVREASSKFGPSSVPGPIIFVFEKVSTFIVT 112 EFPGSK V EASSKFGPS V GPIIFV EKVSTF+VT Sbjct: 94 EFPGSKAVSEASSKFGPSYVSGPIIFVLEKVSTFVVT 130 >ref|XP_009763200.1| PREDICTED: plasma membrane-associated cation-binding protein 1-like isoform X1 [Nicotiana sylvestris] gi|698532767|ref|XP_009763201.1| PREDICTED: plasma membrane-associated cation-binding protein 1-like isoform X1 [Nicotiana sylvestris] Length = 205 Score = 63.5 bits (153), Expect = 6e-08 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = +2 Query: 2 EFPGSKPVREASSKFGPSSVPGPIIFVFEKVSTFIVT 112 EFPGSK V EASSKFGPS V GPIIFV EKVSTF+VT Sbjct: 96 EFPGSKAVSEASSKFGPSYVSGPIIFVLEKVSTFVVT 132 >ref|XP_009600401.1| PREDICTED: plasma membrane-associated cation-binding protein 1-like isoform X2 [Nicotiana tomentosiformis] Length = 195 Score = 63.5 bits (153), Expect = 6e-08 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = +2 Query: 2 EFPGSKPVREASSKFGPSSVPGPIIFVFEKVSTFIVT 112 EFPGSK V EASSKFGPS V GPIIFV EKVSTF+VT Sbjct: 94 EFPGSKAVSEASSKFGPSYVSGPIIFVLEKVSTFVVT 130 >ref|XP_009600368.1| PREDICTED: plasma membrane-associated cation-binding protein 1-like isoform X1 [Nicotiana tomentosiformis] gi|697102304|ref|XP_009600378.1| PREDICTED: plasma membrane-associated cation-binding protein 1-like isoform X1 [Nicotiana tomentosiformis] gi|697102306|ref|XP_009600387.1| PREDICTED: plasma membrane-associated cation-binding protein 1-like isoform X1 [Nicotiana tomentosiformis] gi|697102308|ref|XP_009600393.1| PREDICTED: plasma membrane-associated cation-binding protein 1-like isoform X1 [Nicotiana tomentosiformis] Length = 197 Score = 63.5 bits (153), Expect = 6e-08 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = +2 Query: 2 EFPGSKPVREASSKFGPSSVPGPIIFVFEKVSTFIVT 112 EFPGSK V EASSKFGPS V GPIIFV EKVSTF+VT Sbjct: 96 EFPGSKAVSEASSKFGPSYVSGPIIFVLEKVSTFVVT 132 >ref|XP_002532713.1| endomembrane-associated protein, putative [Ricinus communis] gi|223527559|gb|EEF29680.1| endomembrane-associated protein, putative [Ricinus communis] Length = 209 Score = 63.5 bits (153), Expect = 6e-08 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = +2 Query: 2 EFPGSKPVREASSKFGPSSVPGPIIFVFEKVSTFIV 109 EFPGSKPV EASSKFGP+ V GP+ F+FEKVSTFIV Sbjct: 96 EFPGSKPVSEASSKFGPAYVSGPVYFIFEKVSTFIV 131 >ref|XP_006448567.1| hypothetical protein CICLE_v10016618mg [Citrus clementina] gi|557551178|gb|ESR61807.1| hypothetical protein CICLE_v10016618mg [Citrus clementina] Length = 155 Score = 63.5 bits (153), Expect = 6e-08 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = +2 Query: 2 EFPGSKPVREASSKFGPSSVPGPIIFVFEKVSTFIVT 112 EFPGSK EASSKFG +SVPGP+ F+FEKVSTFIVT Sbjct: 33 EFPGSKAASEASSKFGAASVPGPVFFIFEKVSTFIVT 69 >ref|XP_006448565.1| hypothetical protein CICLE_v10016618mg [Citrus clementina] gi|567912505|ref|XP_006448566.1| hypothetical protein CICLE_v10016618mg [Citrus clementina] gi|557551176|gb|ESR61805.1| hypothetical protein CICLE_v10016618mg [Citrus clementina] gi|557551177|gb|ESR61806.1| hypothetical protein CICLE_v10016618mg [Citrus clementina] Length = 220 Score = 63.5 bits (153), Expect = 6e-08 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = +2 Query: 2 EFPGSKPVREASSKFGPSSVPGPIIFVFEKVSTFIVT 112 EFPGSK EASSKFG +SVPGP+ F+FEKVSTFIVT Sbjct: 98 EFPGSKAASEASSKFGAASVPGPVFFIFEKVSTFIVT 134 >ref|XP_009620274.1| PREDICTED: plasma membrane-associated cation-binding protein 1-like [Nicotiana tomentosiformis] Length = 222 Score = 63.2 bits (152), Expect = 7e-08 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = +2 Query: 2 EFPGSKPVREASSKFGPSSVPGPIIFVFEKVSTFIVT 112 EFPGSK V EASS FGPS V GP++FVFEKVSTFIVT Sbjct: 96 EFPGSKAVSEASSNFGPSYVSGPVLFVFEKVSTFIVT 132 >ref|XP_009368571.1| PREDICTED: plasma membrane-associated cation-binding protein 1-like [Pyrus x bretschneideri] gi|694385508|ref|XP_009368572.1| PREDICTED: plasma membrane-associated cation-binding protein 1-like [Pyrus x bretschneideri] Length = 214 Score = 63.2 bits (152), Expect = 7e-08 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = +2 Query: 2 EFPGSKPVREASSKFGPSSVPGPIIFVFEKVSTFIV 109 EFPGSKPV EASSK+GP+ V GP+ FVFEKVSTFIV Sbjct: 97 EFPGSKPVSEASSKYGPAYVSGPVFFVFEKVSTFIV 132 >ref|XP_010051796.1| PREDICTED: plasma membrane-associated cation-binding protein 1 [Eucalyptus grandis] gi|702315563|ref|XP_010051797.1| PREDICTED: plasma membrane-associated cation-binding protein 1 [Eucalyptus grandis] gi|702315570|ref|XP_010051798.1| PREDICTED: plasma membrane-associated cation-binding protein 1 [Eucalyptus grandis] gi|629110671|gb|KCW75631.1| hypothetical protein EUGRSUZ_D00001 [Eucalyptus grandis] gi|629110672|gb|KCW75632.1| hypothetical protein EUGRSUZ_D00001 [Eucalyptus grandis] Length = 179 Score = 63.2 bits (152), Expect = 7e-08 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +2 Query: 2 EFPGSKPVREASSKFGPSSVPGPIIFVFEKVSTFIVT 112 EFPGSKPV EAS+K+GP V GP++FVFEKVSTFI+T Sbjct: 95 EFPGSKPVSEASTKYGPVLVSGPVLFVFEKVSTFIIT 131 >ref|XP_009764366.1| PREDICTED: plasma membrane-associated cation-binding protein 1-like [Nicotiana sylvestris] gi|2764992|emb|CAA69901.1| plasma membrane polypeptide [Nicotiana tabacum] Length = 215 Score = 63.2 bits (152), Expect = 7e-08 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = +2 Query: 2 EFPGSKPVREASSKFGPSSVPGPIIFVFEKVSTFIVT 112 EFPGSK V EASS FGPS V GP++FVFEKVSTFIVT Sbjct: 96 EFPGSKAVSEASSNFGPSYVSGPVLFVFEKVSTFIVT 132