BLASTX nr result
ID: Coptis25_contig00046405
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00046405 (290 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003520747.1| PREDICTED: uncharacterized protein LOC100788... 56 4e-06 >ref|XP_003520747.1| PREDICTED: uncharacterized protein LOC100788260 [Glycine max] Length = 586 Score = 55.8 bits (133), Expect = 4e-06 Identities = 23/42 (54%), Positives = 35/42 (83%) Frame = +3 Query: 9 EVVIEEGYFEDGGDELIDARAEEFIANFYEEMRLQRLESITR 134 EV++E+ + + GD +IDA+AE+FIA FY+EM+LQRL+S+ R Sbjct: 396 EVIVEDSHVDGDGDWMIDAKAEDFIAQFYQEMKLQRLDSVDR 437