BLASTX nr result
ID: Coptis25_contig00046276
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00046276 (341 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002281374.2| PREDICTED: uncharacterized protein LOC100261... 70 2e-10 ref|XP_002516542.1| ice binding protein, putative [Ricinus commu... 67 1e-09 ref|XP_003523737.1| PREDICTED: uncharacterized protein LOC100814... 63 3e-08 ref|XP_003527833.1| PREDICTED: uncharacterized protein LOC100815... 61 1e-07 emb|CBI20866.3| unnamed protein product [Vitis vinifera] 60 1e-07 >ref|XP_002281374.2| PREDICTED: uncharacterized protein LOC100261152 [Vitis vinifera] Length = 389 Score = 69.7 bits (169), Expect = 2e-10 Identities = 36/59 (61%), Positives = 46/59 (77%) Frame = -3 Query: 267 SHISQQLPPLQSSTNNHQIESEDTKLYKSVLKGKTIGRRLKDQREKKKQEIRTHNARLH 91 S I QQLP S + + +S+D KLYKS+++GKT GR LKDQ+E+KKQEIRTHNA+LH Sbjct: 86 SQIIQQLPGGGSPPISPR-DSDDMKLYKSIMRGKTFGRWLKDQKERKKQEIRTHNAQLH 143 >ref|XP_002516542.1| ice binding protein, putative [Ricinus communis] gi|223544362|gb|EEF45883.1| ice binding protein, putative [Ricinus communis] Length = 422 Score = 67.0 bits (162), Expect = 1e-09 Identities = 29/40 (72%), Positives = 38/40 (95%) Frame = -3 Query: 210 ESEDTKLYKSVLKGKTIGRRLKDQREKKKQEIRTHNARLH 91 +SE+ KLY+S+LKG+T+GR LKDQ+E+KKQEIRTHNA+LH Sbjct: 125 DSEEMKLYRSILKGRTMGRWLKDQKERKKQEIRTHNAQLH 164 >ref|XP_003523737.1| PREDICTED: uncharacterized protein LOC100814154 [Glycine max] Length = 397 Score = 62.8 bits (151), Expect = 3e-08 Identities = 27/40 (67%), Positives = 36/40 (90%) Frame = -3 Query: 210 ESEDTKLYKSVLKGKTIGRRLKDQREKKKQEIRTHNARLH 91 +S + KLY+S+L+G+T+GR LKDQ+E+KKQEIRTHNA LH Sbjct: 112 DSNEKKLYRSLLRGRTMGRWLKDQKERKKQEIRTHNAHLH 151 >ref|XP_003527833.1| PREDICTED: uncharacterized protein LOC100815080 [Glycine max] Length = 400 Score = 60.8 bits (146), Expect = 1e-07 Identities = 26/40 (65%), Positives = 35/40 (87%) Frame = -3 Query: 210 ESEDTKLYKSVLKGKTIGRRLKDQREKKKQEIRTHNARLH 91 +S + KLY+S+L+G+T+GR LKDQ+E+KK EIRTHNA LH Sbjct: 115 DSNEKKLYRSLLRGRTMGRWLKDQKERKKHEIRTHNAHLH 154 >emb|CBI20866.3| unnamed protein product [Vitis vinifera] Length = 424 Score = 60.5 bits (145), Expect = 1e-07 Identities = 26/34 (76%), Positives = 32/34 (94%) Frame = -3 Query: 192 LYKSVLKGKTIGRRLKDQREKKKQEIRTHNARLH 91 LYKS+++GKT GR LKDQ+E+KKQEIRTHNA+LH Sbjct: 145 LYKSIMRGKTFGRWLKDQKERKKQEIRTHNAQLH 178