BLASTX nr result
ID: Coptis25_contig00044399
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00044399 (240 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AER13161.1| putative non-LTR retroelement [Phaseolus vulgaris] 58 7e-07 >gb|AER13161.1| putative non-LTR retroelement [Phaseolus vulgaris] Length = 685 Score = 58.2 bits (139), Expect = 7e-07 Identities = 32/71 (45%), Positives = 41/71 (57%) Frame = +1 Query: 22 IPNGAIASFIPLAPKDKSASKLSHYKSICMGNFLIKIFSKIMQQRLNTIFEDLVSKEQSD 201 IP G ASFI L PK K SKL Y+ I + L KI SK++ RL +F ++ + QS Sbjct: 197 IPKGCNASFITLIPKIKDPSKLEQYRLISLVGALYKIISKVLASRLKKVFLAIIYEIQSS 256 Query: 202 FIKGRSSQVSI 234 F+KGR SI Sbjct: 257 FLKGRGILDSI 267