BLASTX nr result
ID: Coptis25_contig00044339
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00044339 (446 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAD32866.1|AC005489_4 F14N23.4 [Arabidopsis thaliana] 63 3e-08 dbj|BAF00918.1| putative reverse transcriptase [Arabidopsis thal... 63 3e-08 gb|AAD15471.1| putative non-LTR retroelement reverse transcripta... 61 1e-07 gb|AAD08951.1| putative reverse transcriptase [Arabidopsis thali... 59 5e-07 gb|AAD22330.1| putative non-LTR retroelement reverse transcripta... 59 5e-07 >gb|AAD32866.1|AC005489_4 F14N23.4 [Arabidopsis thaliana] Length = 1161 Score = 62.8 bits (151), Expect = 3e-08 Identities = 30/65 (46%), Positives = 40/65 (61%) Frame = +1 Query: 196 FVMIMEILNSLLQTGLQRRDFKPHPSCKTTKVTHLCFADDVLIFIQGYEDSIWGLKLILD 375 FV++M++L+ L G F HP+C +THL FADDVL+F G SI G+ ILD Sbjct: 704 FVLVMDVLSKSLDLGALNGLFNLHPNCLAPIITHLSFADDVLVFSDGAASSIAGILTILD 763 Query: 376 DFSRG 390 DF +G Sbjct: 764 DFRQG 768 >dbj|BAF00918.1| putative reverse transcriptase [Arabidopsis thaliana] Length = 910 Score = 62.8 bits (151), Expect = 3e-08 Identities = 30/65 (46%), Positives = 40/65 (61%) Frame = +1 Query: 196 FVMIMEILNSLLQTGLQRRDFKPHPSCKTTKVTHLCFADDVLIFIQGYEDSIWGLKLILD 375 FV++M++L+ L G F HP+C +THL FADDVL+F G SI G+ ILD Sbjct: 661 FVLVMDVLSKSLDLGALNGLFNLHPNCLAPIITHLSFADDVLVFSDGAASSIAGILTILD 720 Query: 376 DFSRG 390 DF +G Sbjct: 721 DFRQG 725 >gb|AAD15471.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis thaliana] Length = 1277 Score = 60.8 bits (146), Expect = 1e-07 Identities = 30/85 (35%), Positives = 47/85 (55%), Gaps = 2/85 (2%) Frame = +1 Query: 196 FVMIMEILNSLLQTGLQRRDFKPHPSCKTTKVTHLCFADDVLIFIQGYEDSIWGLKLILD 375 FV+ M +L+ ++ R+ HP CK +THLCFADD+++FI G + S+ G+ I Sbjct: 809 FVICMNVLSHMIDVAAVHRNIGYHPKCKKLSLTHLCFADDLMVFIDGQQRSVEGVINIFK 868 Query: 376 DFS--RGYRSAAEPKQIYHQDGSHL 444 DF+ G + E +Y + S L Sbjct: 869 DFAGKSGLHISLEKSTLYLAEVSEL 893 >gb|AAD08951.1| putative reverse transcriptase [Arabidopsis thaliana] gi|20197043|gb|AAM14892.1| putative reverse transcriptase [Arabidopsis thaliana] Length = 1412 Score = 58.5 bits (140), Expect = 5e-07 Identities = 25/63 (39%), Positives = 39/63 (61%) Frame = +1 Query: 196 FVMIMEILNSLLQTGLQRRDFKPHPSCKTTKVTHLCFADDVLIFIQGYEDSIWGLKLILD 375 FV+ M +L+++L G + F HP C+ +THLCFADD+++F G S+ G+ I Sbjct: 922 FVICMNVLSAMLDKGAVEKRFGYHPRCRNMGLTHLCFADDIMVFSAGSAHSLEGVLAIFK 981 Query: 376 DFS 384 DF+ Sbjct: 982 DFA 984 >gb|AAD22330.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis thaliana] Length = 631 Score = 58.5 bits (140), Expect = 5e-07 Identities = 28/78 (35%), Positives = 44/78 (56%), Gaps = 2/78 (2%) Frame = +1 Query: 196 FVMIMEILNSLLQTGLQRRDFKPHPSCKTTKVTHLCFADDVLIFIQGYEDSIWGLKLILD 375 FV+ M +L+ ++ RR+ HP CK +THLCF DD+++FI G + SI G+ I Sbjct: 237 FVICMNVLSHMIDEAAVRRNIGYHPKCKKLSLTHLCFVDDLMVFIDGQQRSIEGVINIFH 296 Query: 376 DFS--RGYRSAAEPKQIY 423 +F+ G + E +Y Sbjct: 297 EFAGKSGLHISLEKSTLY 314