BLASTX nr result
ID: Coptis25_contig00044323
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00044323 (294 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAJ53232.1| JHL06P13.13 [Jatropha curcas] 55 5e-06 emb|CBI36296.3| unnamed protein product [Vitis vinifera] 55 6e-06 >dbj|BAJ53232.1| JHL06P13.13 [Jatropha curcas] Length = 444 Score = 55.5 bits (132), Expect = 5e-06 Identities = 26/44 (59%), Positives = 29/44 (65%) Frame = -3 Query: 133 PSTTPFPVNYFYIAPPSSSSTQRKSDIWSVPRLVEWRPCKWWIQ 2 PSTT F SS S+ RK DIWSV R+VEWRPCKWW+Q Sbjct: 27 PSTTLFSSTI----SSSSDSSTRKLDIWSVRRIVEWRPCKWWLQ 66 >emb|CBI36296.3| unnamed protein product [Vitis vinifera] Length = 443 Score = 55.1 bits (131), Expect = 6e-06 Identities = 24/39 (61%), Positives = 28/39 (71%) Frame = -3 Query: 121 PFPVNYFYIAPPSSSSTQRKSDIWSVPRLVEWRPCKWWI 5 P P + F ++P S S RK DIWSV RLVEWRPCKWW+ Sbjct: 29 PSPFSQFSLSPTSPS---RKFDIWSVRRLVEWRPCKWWL 64