BLASTX nr result
ID: Coptis25_contig00043852
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00043852 (360 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519815.1| conserved hypothetical protein [Ricinus comm... 61 8e-08 ref|XP_002280310.1| PREDICTED: uncharacterized protein LOC100245... 60 1e-07 ref|XP_002329513.1| predicted protein [Populus trichocarpa] gi|2... 56 3e-06 >ref|XP_002519815.1| conserved hypothetical protein [Ricinus communis] gi|223540861|gb|EEF42419.1| conserved hypothetical protein [Ricinus communis] Length = 114 Score = 61.2 bits (147), Expect = 8e-08 Identities = 35/78 (44%), Positives = 48/78 (61%), Gaps = 6/78 (7%) Frame = +1 Query: 1 WSGGLSTPPRYKKIRNETSMLINKNVNVKKTHRRMVSL-----ERDCAPRLVRSGGMRRD 165 WSG L TPP Y+++ S + + + KK HRR+ S+ + P+L+RS GMRRD Sbjct: 38 WSGNL-TPPPYEQVGKGNSAVAARKI--KKDHRRLKSMGAIAFKGTDEPKLIRSSGMRRD 94 Query: 166 WSFEDLRHRRN-GKKNCR 216 WSFEDLR R + +K CR Sbjct: 95 WSFEDLRQRGDQDRKECR 112 >ref|XP_002280310.1| PREDICTED: uncharacterized protein LOC100245481 [Vitis vinifera] gi|147856529|emb|CAN80327.1| hypothetical protein VITISV_002985 [Vitis vinifera] Length = 106 Score = 60.5 bits (145), Expect = 1e-07 Identities = 33/70 (47%), Positives = 45/70 (64%), Gaps = 1/70 (1%) Frame = +1 Query: 1 WSGGLSTPPR-YKKIRNETSMLINKNVNVKKTHRRMVSLERDCAPRLVRSGGMRRDWSFE 177 WSG L+ PP Y +R+ ++ K HRR+ S+ + P+L+RSGGMRRDWSFE Sbjct: 39 WSGNLAPPPPPYGSMRHGSAKKAGKG------HRRLNSVGEE--PKLIRSGGMRRDWSFE 90 Query: 178 DLRHRRNGKK 207 DLR RR+ K+ Sbjct: 91 DLRQRRDEKR 100 >ref|XP_002329513.1| predicted protein [Populus trichocarpa] gi|222870222|gb|EEF07353.1| predicted protein [Populus trichocarpa] Length = 111 Score = 55.8 bits (133), Expect = 3e-06 Identities = 33/72 (45%), Positives = 44/72 (61%), Gaps = 5/72 (6%) Frame = +1 Query: 1 WSGGLSTPPRYKKIRNETSMLINKNVNVKKTHRRM-----VSLERDCAPRLVRSGGMRRD 165 WSG LS PP Y ++ +++ + V +KK RR+ V+ + P+LVRS GMRRD Sbjct: 40 WSGKLS-PPSYGQVGRNSNLFSARRV-IKKEPRRLNITGGVTFKGCDEPKLVRSSGMRRD 97 Query: 166 WSFEDLRHRRNG 201 WSFEDLR NG Sbjct: 98 WSFEDLRKACNG 109