BLASTX nr result
ID: Coptis25_contig00043770
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00043770 (267 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530965.1| conserved hypothetical protein [Ricinus comm... 62 4e-08 ref|XP_002319207.1| predicted protein [Populus trichocarpa] gi|2... 57 2e-06 ref|XP_002325891.1| predicted protein [Populus trichocarpa] gi|2... 57 2e-06 >ref|XP_002530965.1| conserved hypothetical protein [Ricinus communis] gi|223529480|gb|EEF31437.1| conserved hypothetical protein [Ricinus communis] Length = 1204 Score = 62.4 bits (150), Expect = 4e-08 Identities = 23/42 (54%), Positives = 35/42 (83%) Frame = +2 Query: 140 MGMDAMEIRVQIQKVLIFTMKTCYRSACDHPFILGXLCFFIF 265 MG+DAM IRV+I++ L+ +++TCY+S C HPF++G +CF IF Sbjct: 1 MGLDAMRIRVEIKRFLVISIRTCYKSVCKHPFLVGFVCFLIF 42 >ref|XP_002319207.1| predicted protein [Populus trichocarpa] gi|222857583|gb|EEE95130.1| predicted protein [Populus trichocarpa] Length = 1661 Score = 57.0 bits (136), Expect = 2e-06 Identities = 21/41 (51%), Positives = 32/41 (78%) Frame = +2 Query: 140 MGMDAMEIRVQIQKVLIFTMKTCYRSACDHPFILGXLCFFI 262 MG+DAM IRVQI++ L+ + + CYRS C HPF++G +C+ + Sbjct: 1 MGIDAMRIRVQIRRFLVISFQLCYRSVCKHPFLVGMVCYLL 41 >ref|XP_002325891.1| predicted protein [Populus trichocarpa] gi|222862766|gb|EEF00273.1| predicted protein [Populus trichocarpa] Length = 1384 Score = 56.6 bits (135), Expect = 2e-06 Identities = 21/42 (50%), Positives = 32/42 (76%) Frame = +2 Query: 137 KMGMDAMEIRVQIQKVLIFTMKTCYRSACDHPFILGXLCFFI 262 +MG+DAM+IRVQI+K + + CYRS C HPF++G +C+ + Sbjct: 15 RMGIDAMKIRVQIRKFSVILFRLCYRSVCKHPFLVGMVCYLL 56