BLASTX nr result
ID: Coptis25_contig00043639
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00043639 (383 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003635218.1| PREDICTED: TPR repeat-containing thioredoxin... 91 1e-16 emb|CBI40996.3| unnamed protein product [Vitis vinifera] 91 1e-16 ref|XP_003543765.1| PREDICTED: TPR repeat-containing thioredoxin... 91 1e-16 ref|XP_003615062.1| Small glutamine-rich tetratricopeptide repea... 88 8e-16 ref|XP_003544787.1| PREDICTED: TPR repeat-containing thioredoxin... 86 3e-15 >ref|XP_003635218.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Vitis vinifera] Length = 710 Score = 90.9 bits (224), Expect = 1e-16 Identities = 40/65 (61%), Positives = 57/65 (87%) Frame = -2 Query: 370 QLIEQLSKRHRSVNFLKVDVDDNPNVAKAEGINSLPTFRIYKNGSRVKDISGTDHDLLED 191 Q +EQL KR+ SVNFLKV+V+++PN+A++EG++SLP F+IYKNGSRVK+ISG + DLLE Sbjct: 644 QFMEQLCKRYPSVNFLKVEVEEHPNIARSEGVSSLPAFKIYKNGSRVKEISGDNLDLLES 703 Query: 190 SISNY 176 ++ +Y Sbjct: 704 TVKSY 708 >emb|CBI40996.3| unnamed protein product [Vitis vinifera] Length = 701 Score = 90.9 bits (224), Expect = 1e-16 Identities = 40/65 (61%), Positives = 57/65 (87%) Frame = -2 Query: 370 QLIEQLSKRHRSVNFLKVDVDDNPNVAKAEGINSLPTFRIYKNGSRVKDISGTDHDLLED 191 Q +EQL KR+ SVNFLKV+V+++PN+A++EG++SLP F+IYKNGSRVK+ISG + DLLE Sbjct: 635 QFMEQLCKRYPSVNFLKVEVEEHPNIARSEGVSSLPAFKIYKNGSRVKEISGDNLDLLES 694 Query: 190 SISNY 176 ++ +Y Sbjct: 695 TVKSY 699 >ref|XP_003543765.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Glycine max] Length = 703 Score = 90.5 bits (223), Expect = 1e-16 Identities = 40/66 (60%), Positives = 57/66 (86%) Frame = -2 Query: 367 LIEQLSKRHRSVNFLKVDVDDNPNVAKAEGINSLPTFRIYKNGSRVKDISGTDHDLLEDS 188 ++EQ+SKR SVNFLKV+++D+P +AK+EG++S+P F+IYKNGSRVK+ISG +H+LLE S Sbjct: 638 VLEQISKRFPSVNFLKVEIEDHPYLAKSEGVSSIPAFKIYKNGSRVKEISGNNHELLERS 697 Query: 187 ISNYCS 170 + Y S Sbjct: 698 VKLYSS 703 >ref|XP_003615062.1| Small glutamine-rich tetratricopeptide repeat-containing protein [Medicago truncatula] gi|355516397|gb|AES98020.1| Small glutamine-rich tetratricopeptide repeat-containing protein [Medicago truncatula] Length = 676 Score = 87.8 bits (216), Expect = 8e-16 Identities = 39/68 (57%), Positives = 55/68 (80%) Frame = -2 Query: 373 TQLIEQLSKRHRSVNFLKVDVDDNPNVAKAEGINSLPTFRIYKNGSRVKDISGTDHDLLE 194 + ++EQ SKR SVNFLKV+++D+P +AK+EG++S P F+IYKNGSRVK+ISG +H+ LE Sbjct: 609 SMVLEQTSKRFPSVNFLKVEIEDHPYLAKSEGVSSFPAFKIYKNGSRVKEISGNNHEFLE 668 Query: 193 DSISNYCS 170 S+ Y S Sbjct: 669 KSVKFYSS 676 >ref|XP_003544787.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Glycine max] Length = 694 Score = 85.9 bits (211), Expect = 3e-15 Identities = 38/66 (57%), Positives = 55/66 (83%) Frame = -2 Query: 367 LIEQLSKRHRSVNFLKVDVDDNPNVAKAEGINSLPTFRIYKNGSRVKDISGTDHDLLEDS 188 ++EQ+SKR SVNFLKV+++D+P +AK+E ++S+P F+IYKNGS VK+ISG +H+LLE S Sbjct: 629 VLEQISKRFPSVNFLKVEIEDHPYLAKSESVSSIPAFKIYKNGSSVKEISGNNHELLERS 688 Query: 187 ISNYCS 170 + Y S Sbjct: 689 VKLYSS 694