BLASTX nr result
ID: Coptis25_contig00043394
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00043394 (271 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518909.1| alpha/beta hydrolase domain containing prote... 65 7e-09 emb|CBI34585.3| unnamed protein product [Vitis vinifera] 61 1e-07 ref|XP_002280182.1| PREDICTED: embryogenesis-associated protein ... 61 1e-07 ref|XP_004143840.1| PREDICTED: embryogenesis-associated protein ... 57 1e-06 ref|XP_004163575.1| PREDICTED: embryogenesis-associated protein ... 57 2e-06 >ref|XP_002518909.1| alpha/beta hydrolase domain containing protein 1,3, putative [Ricinus communis] gi|223541896|gb|EEF43442.1| alpha/beta hydrolase domain containing protein 1,3, putative [Ricinus communis] Length = 425 Score = 64.7 bits (156), Expect = 7e-09 Identities = 35/65 (53%), Positives = 43/65 (66%), Gaps = 8/65 (12%) Frame = +3 Query: 99 HHPSLHI-TNTFTTMSQ-------TLELTGGARDTYLSVFKSLNLPYNPFPIICWNRHLE 254 HHPS + T TTMS +LE+ GGARDT+L +FK+L+ PY FP+I NRH E Sbjct: 28 HHPSSTVQVATATTMSDDETRPHPSLEVIGGARDTFLPIFKTLHRPYKTFPLIGHNRHFE 87 Query: 255 TIFAS 269 TIFAS Sbjct: 88 TIFAS 92 >emb|CBI34585.3| unnamed protein product [Vitis vinifera] Length = 386 Score = 60.8 bits (146), Expect = 1e-07 Identities = 25/41 (60%), Positives = 33/41 (80%) Frame = +3 Query: 147 TLELTGGARDTYLSVFKSLNLPYNPFPIICWNRHLETIFAS 269 +LE+ GG D+YL FK+LN PY+ FP++ WNRH+ETIFAS Sbjct: 12 SLEVLGGGLDSYLPAFKTLNRPYDAFPVVGWNRHVETIFAS 52 >ref|XP_002280182.1| PREDICTED: embryogenesis-associated protein EMB8 [Vitis vinifera] Length = 424 Score = 60.8 bits (146), Expect = 1e-07 Identities = 25/41 (60%), Positives = 33/41 (80%) Frame = +3 Query: 147 TLELTGGARDTYLSVFKSLNLPYNPFPIICWNRHLETIFAS 269 +LE+ GG D+YL FK+LN PY+ FP++ WNRH+ETIFAS Sbjct: 50 SLEVLGGGLDSYLPAFKTLNRPYDAFPVVGWNRHVETIFAS 90 >ref|XP_004143840.1| PREDICTED: embryogenesis-associated protein EMB8-like [Cucumis sativus] Length = 480 Score = 57.0 bits (136), Expect(2) = 1e-06 Identities = 26/41 (63%), Positives = 31/41 (75%) Frame = +3 Query: 147 TLELTGGARDTYLSVFKSLNLPYNPFPIICWNRHLETIFAS 269 +LE+ GG D +L FK L+LPY PFP+I NRHLETIFAS Sbjct: 115 SLEVIGGGCDQFLPAFKDLDLPYKPFPVIGSNRHLETIFAS 155 Score = 20.4 bits (41), Expect(2) = 1e-06 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = +2 Query: 56 PQNSPSFQLHSSKKTPPFSSHNQ 124 P +SP L S TP F NQ Sbjct: 64 PSSSPLIALRLSSFTPSFFLTNQ 86 >ref|XP_004163575.1| PREDICTED: embryogenesis-associated protein EMB8-like [Cucumis sativus] Length = 372 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/41 (63%), Positives = 31/41 (75%) Frame = +3 Query: 147 TLELTGGARDTYLSVFKSLNLPYNPFPIICWNRHLETIFAS 269 +LE+ GG D +L FK L+LPY PFP+I NRHLETIFAS Sbjct: 15 SLEVIGGGCDQFLPAFKDLDLPYKPFPVIGSNRHLETIFAS 55