BLASTX nr result
ID: Coptis25_contig00043381
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00043381 (281 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524773.1| serine-threonine protein kinase, plant-type,... 91 7e-17 ref|XP_002321045.1| predicted protein [Populus trichocarpa] gi|2... 90 2e-16 gb|AAF86511.1|AC002560_4 F21B7.6 [Arabidopsis thaliana] gi|12083... 89 3e-16 ref|NP_563685.2| leucine-rich repeat-containing protein [Arabido... 89 3e-16 ref|XP_002889459.1| leucine-rich repeat family protein [Arabidop... 89 4e-16 >ref|XP_002524773.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223535957|gb|EEF37616.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Length = 400 Score = 91.3 bits (225), Expect = 7e-17 Identities = 43/55 (78%), Positives = 48/55 (87%) Frame = -3 Query: 165 DPTDFLALQAIRKSLTDMPGSKFFTSWDFTSDPCSFTGVNCDSNSNRVIALNLGD 1 DP DFLALQ+IRKSL DMPGS FFTSWDFTSDPC+F GV CD +++VIALNLGD Sbjct: 30 DPMDFLALQSIRKSLEDMPGSNFFTSWDFTSDPCNFAGVYCD--ADKVIALNLGD 82 >ref|XP_002321045.1| predicted protein [Populus trichocarpa] gi|222861818|gb|EEE99360.1| predicted protein [Populus trichocarpa] Length = 399 Score = 89.7 bits (221), Expect = 2e-16 Identities = 42/55 (76%), Positives = 47/55 (85%) Frame = -3 Query: 165 DPTDFLALQAIRKSLTDMPGSKFFTSWDFTSDPCSFTGVNCDSNSNRVIALNLGD 1 DP DFLALQ++RKSL DMPGS FF SWDFTSDPC+F GV C+ S+RVIALNLGD Sbjct: 29 DPLDFLALQSVRKSLDDMPGSNFFASWDFTSDPCNFAGVYCE--SDRVIALNLGD 81 >gb|AAF86511.1|AC002560_4 F21B7.6 [Arabidopsis thaliana] gi|12083226|gb|AAG48772.1|AF332409_1 unknown protein [Arabidopsis thaliana] Length = 395 Score = 89.4 bits (220), Expect = 3e-16 Identities = 42/55 (76%), Positives = 46/55 (83%) Frame = -3 Query: 165 DPTDFLALQAIRKSLTDMPGSKFFTSWDFTSDPCSFTGVNCDSNSNRVIALNLGD 1 DP DFLALQAIRKSL D+PGSKFF SWDFTSDPC F GV C N ++VI+LNLGD Sbjct: 25 DPVDFLALQAIRKSLDDLPGSKFFESWDFTSDPCGFAGVYC--NGDKVISLNLGD 77 >ref|NP_563685.2| leucine-rich repeat-containing protein [Arabidopsis thaliana] gi|332189450|gb|AEE27571.1| leucine-rich repeat-containing protein [Arabidopsis thaliana] Length = 397 Score = 89.4 bits (220), Expect = 3e-16 Identities = 42/55 (76%), Positives = 46/55 (83%) Frame = -3 Query: 165 DPTDFLALQAIRKSLTDMPGSKFFTSWDFTSDPCSFTGVNCDSNSNRVIALNLGD 1 DP DFLALQAIRKSL D+PGSKFF SWDFTSDPC F GV C N ++VI+LNLGD Sbjct: 27 DPVDFLALQAIRKSLDDLPGSKFFESWDFTSDPCGFAGVYC--NGDKVISLNLGD 79 >ref|XP_002889459.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] gi|297335301|gb|EFH65718.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] Length = 396 Score = 89.0 bits (219), Expect = 4e-16 Identities = 42/55 (76%), Positives = 45/55 (81%) Frame = -3 Query: 165 DPTDFLALQAIRKSLTDMPGSKFFTSWDFTSDPCSFTGVNCDSNSNRVIALNLGD 1 DP DFLALQAIRKSL D+PGSKFF SWDFTSDPC F GV CD +VI+LNLGD Sbjct: 26 DPVDFLALQAIRKSLDDLPGSKFFESWDFTSDPCGFAGVYCD--GEKVISLNLGD 78