BLASTX nr result
ID: Coptis25_contig00043276
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00043276 (397 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN79781.1| hypothetical protein VITISV_041886 [Vitis vinifera] 69 3e-10 emb|CAN71427.1| hypothetical protein VITISV_027864 [Vitis vinifera] 64 2e-08 emb|CAN73532.1| hypothetical protein VITISV_012827 [Vitis vinifera] 62 4e-08 >emb|CAN79781.1| hypothetical protein VITISV_041886 [Vitis vinifera] Length = 530 Score = 69.3 bits (168), Expect = 3e-10 Identities = 28/53 (52%), Positives = 35/53 (66%) Frame = -3 Query: 254 KTPIRLFCTRYNEQKKGWRCVDPTTNTAYVSPRVIFDDVSSWWSTENVVLPDS 96 K +R Y+ Q+KGWRC DPTT Y S V+FD+ SSWWS+E +LPDS Sbjct: 385 KKAVRCVLVGYDSQRKGWRCCDPTTGKCYTSRNVVFDESSSWWSSEKEILPDS 437 >emb|CAN71427.1| hypothetical protein VITISV_027864 [Vitis vinifera] Length = 1300 Score = 63.5 bits (153), Expect = 2e-08 Identities = 26/53 (49%), Positives = 33/53 (62%) Frame = -3 Query: 254 KTPIRLFCTRYNEQKKGWRCVDPTTNTAYVSPRVIFDDVSSWWSTENVVLPDS 96 K +R Y+ Q+K WRC DPTT Y S V+FD+ SSWWS+E +L DS Sbjct: 663 KKAVRCVLVGYDSQRKXWRCCDPTTGKCYTSRNVVFDESSSWWSSEKEILXDS 715 >emb|CAN73532.1| hypothetical protein VITISV_012827 [Vitis vinifera] Length = 1194 Score = 62.4 bits (150), Expect = 4e-08 Identities = 26/53 (49%), Positives = 33/53 (62%) Frame = -3 Query: 254 KTPIRLFCTRYNEQKKGWRCVDPTTNTAYVSPRVIFDDVSSWWSTENVVLPDS 96 K +R Y+ Q K WRC +PTT Y S V+FD+ SSWWS+E +LPDS Sbjct: 660 KKXVRCVLVGYDSQXKRWRCCNPTTGKYYTSRNVVFDESSSWWSSEKEILPDS 712