BLASTX nr result
ID: Coptis25_contig00043247
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00043247 (288 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002281018.1| PREDICTED: pentatricopeptide repeat-containi... 108 6e-22 ref|XP_002520160.1| pentatricopeptide repeat-containing protein,... 79 4e-13 ref|XP_002266244.1| PREDICTED: pentatricopeptide repeat-containi... 79 5e-13 ref|XP_002512787.1| pentatricopeptide repeat-containing protein,... 78 7e-13 ref|XP_003527818.1| PREDICTED: pentatricopeptide repeat-containi... 78 9e-13 >ref|XP_002281018.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Vitis vinifera] Length = 624 Score = 108 bits (269), Expect = 6e-22 Identities = 51/100 (51%), Positives = 72/100 (72%), Gaps = 4/100 (4%) Frame = +1 Query: 1 FTNPFISSKLLMWC----DDISFASLLFKQIENPNIYAWNYMSRIYAHSEMPEKSVFVYN 168 F +P +SSKLL + D +F+ LF QI PN+++WN+M R Y+ S P +++ +YN Sbjct: 57 FRDPVVSSKLLYYSLSHDHDFAFSRTLFFQIHKPNVFSWNFMFRAYSRSSFPAETIALYN 116 Query: 169 MMRRNGVVVPDNYTFPFVLKACSRLLVLDKGREVHLSSLK 288 +M RNG +PDNY+FPFVLKAC+RL +L KGRE+H S+LK Sbjct: 117 LMLRNG-TLPDNYSFPFVLKACARLSLLHKGREIHSSTLK 155 >ref|XP_002520160.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223540652|gb|EEF42215.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 330 Score = 79.0 bits (193), Expect = 4e-13 Identities = 39/95 (41%), Positives = 60/95 (63%), Gaps = 3/95 (3%) Frame = +1 Query: 13 FISSKLLMWC--DDISFASLLFKQIENPNIYAWNYMSRIYAHS-EMPEKSVFVYNMMRRN 183 F+ SK+L + +D+ +A LF + +NPN + WN + R A S + E+S +Y M Sbjct: 65 FLYSKILHFSSFNDLDYAYRLFSKFDNPNAFMWNTLIRACARSYDRKEQSFLLYKRMIEQ 124 Query: 184 GVVVPDNYTFPFVLKACSRLLVLDKGREVHLSSLK 288 G V+PD +T+PFVLKAC+ L L++G++VH LK Sbjct: 125 GAVLPDKHTYPFVLKACAYLFALNEGKQVHAQMLK 159 >ref|XP_002266244.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Vitis vinifera] Length = 722 Score = 78.6 bits (192), Expect = 5e-13 Identities = 34/82 (41%), Positives = 53/82 (64%) Frame = +1 Query: 43 DDISFASLLFKQIENPNIYAWNYMSRIYAHSEMPEKSVFVYNMMRRNGVVVPDNYTFPFV 222 D + + LLF QI+ PN++ WN M R Y+ S+ P +++ +Y M G+ P+N+TFPF+ Sbjct: 58 DGLDHSRLLFSQIDCPNLFMWNTMIRGYSRSDNPREAIVLYMSMIAKGIAPPNNFTFPFL 117 Query: 223 LKACSRLLVLDKGREVHLSSLK 288 L +C+RL L+ G EVH +K Sbjct: 118 LNSCARLSSLEPGHEVHSHIIK 139 >ref|XP_002512787.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223547798|gb|EEF49290.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 480 Score = 78.2 bits (191), Expect = 7e-13 Identities = 38/91 (41%), Positives = 59/91 (64%), Gaps = 3/91 (3%) Frame = +1 Query: 25 KLLMWC---DDISFASLLFKQIENPNIYAWNYMSRIYAHSEMPEKSVFVYNMMRRNGVVV 195 KLL C + +A+L+F QI+NP+ + WN+M R Y ++ ++++ +YN+M G Sbjct: 69 KLLRLCFSYQKVDYATLIFDQIQNPHTFTWNFMIRAYNYNGNSQQALLLYNLMICEG-FS 127 Query: 196 PDNYTFPFVLKACSRLLVLDKGREVHLSSLK 288 PD +TFPFV+KAC LDKG+EVH ++K Sbjct: 128 PDKFTFPFVIKACLDHSALDKGKEVHGFAIK 158 >ref|XP_003527818.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540-like [Glycine max] Length = 535 Score = 77.8 bits (190), Expect = 9e-13 Identities = 34/90 (37%), Positives = 60/90 (66%), Gaps = 3/90 (3%) Frame = +1 Query: 13 FISSKLLMWCDDIS---FASLLFKQIENPNIYAWNYMSRIYAHSEMPEKSVFVYNMMRRN 183 F+ +K+L CD++S +A+++F+Q+ENPN++++N + R Y H+ ++ V+N M Sbjct: 40 FLVTKMLDLCDNLSHVDYATMIFQQLENPNVFSYNAIIRTYTHNHKHPLAITVFNQMLTT 99 Query: 184 GVVVPDNYTFPFVLKACSRLLVLDKGREVH 273 PD +TFPFV+K+C+ LL G++VH Sbjct: 100 KSASPDKFTFPFVIKSCAGLLCRRLGQQVH 129