BLASTX nr result
ID: Coptis25_contig00043232
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00043232 (265 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002283744.1| PREDICTED: mitochondrial inner membrane prot... 122 3e-26 ref|XP_002519717.1| mitochondrial inner membrane protease subuni... 119 3e-25 ref|XP_002522302.1| mitochondrial inner membrane protease subuni... 118 4e-25 ref|XP_004137247.1| PREDICTED: mitochondrial inner membrane prot... 117 1e-24 ref|XP_004134638.1| PREDICTED: mitochondrial inner membrane prot... 116 2e-24 >ref|XP_002283744.1| PREDICTED: mitochondrial inner membrane protease subunit 1 [Vitis vinifera] gi|302142795|emb|CBI20090.3| unnamed protein product [Vitis vinifera] Length = 167 Score = 122 bits (306), Expect = 3e-26 Identities = 52/88 (59%), Positives = 73/88 (82%) Frame = -1 Query: 265 VISSILVQGPSMYPTLNHTGDVILVEKISTKLGKVGPGDIVIVRAPDNPRKTITKRVLGM 86 + + LV GPSM PT N TGDV+LVE ++ ++GKV PGD+V+VR+P+NPRKT++KR+LGM Sbjct: 38 ICTPTLVYGPSMLPTFNLTGDVLLVENLTVRMGKVRPGDVVLVRSPENPRKTVSKRILGM 97 Query: 85 EGDCVSFLVDPAHSECTKSIVVPKGHVW 2 EGD V+F++DP +S +S+V+PKGHVW Sbjct: 98 EGDRVTFMIDPKNSNRCQSVVIPKGHVW 125 >ref|XP_002519717.1| mitochondrial inner membrane protease subunit, putative [Ricinus communis] gi|223541134|gb|EEF42690.1| mitochondrial inner membrane protease subunit, putative [Ricinus communis] Length = 176 Score = 119 bits (297), Expect = 3e-25 Identities = 50/86 (58%), Positives = 72/86 (83%) Frame = -1 Query: 259 SSILVQGPSMYPTLNHTGDVILVEKISTKLGKVGPGDIVIVRAPDNPRKTITKRVLGMEG 80 ++ L GPSM PTLN TGD++L E+IS + GKVGPGDIV+VR+P NP++ +TKRV+G+EG Sbjct: 39 TAALTYGPSMLPTLNLTGDLVLAERISPRFGKVGPGDIVLVRSPVNPKRIVTKRVMGVEG 98 Query: 79 DCVSFLVDPAHSECTKSIVVPKGHVW 2 D V+++VDP +S+ + ++VVPKGH+W Sbjct: 99 DSVTYVVDPKNSDASNTVVVPKGHIW 124 >ref|XP_002522302.1| mitochondrial inner membrane protease subunit, putative [Ricinus communis] gi|223538555|gb|EEF40160.1| mitochondrial inner membrane protease subunit, putative [Ricinus communis] Length = 158 Score = 118 bits (296), Expect = 4e-25 Identities = 50/86 (58%), Positives = 72/86 (83%) Frame = -1 Query: 259 SSILVQGPSMYPTLNHTGDVILVEKISTKLGKVGPGDIVIVRAPDNPRKTITKRVLGMEG 80 ++ L GPSM PTLN TGD++L E+IS + GKVGPGDIV+VR+P NP++ +TKRV+G+EG Sbjct: 37 TAALTYGPSMLPTLNLTGDLVLAERISPRFGKVGPGDIVLVRSPVNPKRIVTKRVMGIEG 96 Query: 79 DCVSFLVDPAHSECTKSIVVPKGHVW 2 D V+++VDP +S+ + +I+VPKGH+W Sbjct: 97 DSVTYIVDPKNSDASNTIMVPKGHIW 122 >ref|XP_004137247.1| PREDICTED: mitochondrial inner membrane protease subunit 1-like [Cucumis sativus] gi|449483132|ref|XP_004156501.1| PREDICTED: mitochondrial inner membrane protease subunit 1-like [Cucumis sativus] Length = 161 Score = 117 bits (293), Expect = 1e-24 Identities = 54/88 (61%), Positives = 70/88 (79%) Frame = -1 Query: 265 VISSILVQGPSMYPTLNHTGDVILVEKISTKLGKVGPGDIVIVRAPDNPRKTITKRVLGM 86 + S LV GPSM PTLN TGDV+L E +S ++G+VGPGD+V+VR+P NPRK +TKR++G+ Sbjct: 32 ICSPTLVYGPSMLPTLNLTGDVLLAEHVSHRVGRVGPGDVVLVRSPRNPRKMLTKRIVGV 91 Query: 85 EGDCVSFLVDPAHSECTKSIVVPKGHVW 2 EGD V+F DPA+S +S VVPKGHVW Sbjct: 92 EGDKVNFYPDPANSNQYQSAVVPKGHVW 119 >ref|XP_004134638.1| PREDICTED: mitochondrial inner membrane protease subunit 1-like isoform 1 [Cucumis sativus] gi|449433708|ref|XP_004134639.1| PREDICTED: mitochondrial inner membrane protease subunit 1-like isoform 2 [Cucumis sativus] gi|449505931|ref|XP_004162607.1| PREDICTED: mitochondrial inner membrane protease subunit 1-like isoform 1 [Cucumis sativus] gi|449505935|ref|XP_004162608.1| PREDICTED: mitochondrial inner membrane protease subunit 1-like isoform 2 [Cucumis sativus] Length = 175 Score = 116 bits (291), Expect = 2e-24 Identities = 49/88 (55%), Positives = 72/88 (81%) Frame = -1 Query: 265 VISSILVQGPSMYPTLNHTGDVILVEKISTKLGKVGPGDIVIVRAPDNPRKTITKRVLGM 86 + ++ GPSM PTLN TGD +L E++ST+ G+VG GDIV+VR+P+NPRK + KR++GM Sbjct: 38 ICTATFTYGPSMLPTLNLTGDFVLAERLSTRFGRVGVGDIVLVRSPENPRKVVGKRLIGM 97 Query: 85 EGDCVSFLVDPAHSECTKSIVVPKGHVW 2 EGD V+++VDP +S+ ++++VVPKGHVW Sbjct: 98 EGDSVTYVVDPKNSDWSETVVVPKGHVW 125