BLASTX nr result
ID: Coptis25_contig00043173
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00043173 (200 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002277390.1| PREDICTED: pentatricopeptide repeat-containi... 73 2e-11 ref|XP_002511313.1| pentatricopeptide repeat-containing protein,... 72 6e-11 ref|XP_003549820.1| PREDICTED: pentatricopeptide repeat-containi... 70 1e-10 ref|XP_004138087.1| PREDICTED: pentatricopeptide repeat-containi... 67 2e-09 ref|XP_003550712.1| PREDICTED: pentatricopeptide repeat-containi... 61 8e-08 >ref|XP_002277390.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Vitis vinifera] Length = 631 Score = 73.2 bits (178), Expect = 2e-11 Identities = 34/63 (53%), Positives = 47/63 (74%) Frame = -2 Query: 190 YQKSYFSSTPSSVVELFRTREWSEELKQELEKAHLSTLSHETVLYVLMKLDQEPLKALDF 11 Y K +FSS P+S+VEL +WS+EL+ ELEK+ S L+HETV+YVL KLD++P + +F Sbjct: 56 YGKLFFSSKPNSIVELVLENDWSDELESELEKSS-SVLTHETVIYVLKKLDKDPQRTWNF 114 Query: 10 FTW 2 F W Sbjct: 115 FNW 117 >ref|XP_002511313.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223550428|gb|EEF51915.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 627 Score = 71.6 bits (174), Expect = 6e-11 Identities = 35/65 (53%), Positives = 46/65 (70%) Frame = -2 Query: 196 NTYQKSYFSSTPSSVVELFRTREWSEELKQELEKAHLSTLSHETVLYVLMKLDQEPLKAL 17 N ++K Y SS PSS+VEL +WS EL+ +LE + L+HETV+YVL KLD++P KA Sbjct: 52 NIHKKLYSSSKPSSLVELLSVNDWSPELETQLENSS-PLLTHETVIYVLKKLDKDPHKAW 110 Query: 16 DFFTW 2 DFF W Sbjct: 111 DFFNW 115 >ref|XP_003549820.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Glycine max] Length = 635 Score = 70.5 bits (171), Expect = 1e-10 Identities = 34/65 (52%), Positives = 47/65 (72%) Frame = -2 Query: 196 NTYQKSYFSSTPSSVVELFRTREWSEELKQELEKAHLSTLSHETVLYVLMKLDQEPLKAL 17 N +Q YFSS P+S+VEL T +WS+ L+QELEK + S ++HETV+YVL +++ P KA Sbjct: 57 NIHQNLYFSSKPNSIVELVLTSDWSKGLEQELEKCYPS-MTHETVVYVLKRMEANPEKAW 115 Query: 16 DFFTW 2 FF W Sbjct: 116 CFFNW 120 >ref|XP_004138087.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Cucumis sativus] gi|449524136|ref|XP_004169079.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Cucumis sativus] Length = 632 Score = 67.0 bits (162), Expect = 2e-09 Identities = 31/59 (52%), Positives = 44/59 (74%) Frame = -2 Query: 178 YFSSTPSSVVELFRTREWSEELKQELEKAHLSTLSHETVLYVLMKLDQEPLKALDFFTW 2 +FSS P S+++L T +WSE L+ ELE + TL+HETV+YVL +LD++P KA +FF W Sbjct: 53 FFSSNPQSLLQLVSTNDWSEMLETELETLN-PTLTHETVVYVLKRLDKQPQKASEFFNW 110 >ref|XP_003550712.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Glycine max] Length = 635 Score = 61.2 bits (147), Expect = 8e-08 Identities = 31/66 (46%), Positives = 44/66 (66%), Gaps = 2/66 (3%) Frame = -2 Query: 193 TYQKSYFSSTP--SSVVELFRTREWSEELKQELEKAHLSTLSHETVLYVLMKLDQEPLKA 20 T+ K YFS+ P +S+VEL T +WS+ L+ +LE ++ HETVLYV+ +LD+ P KA Sbjct: 52 THHKLYFSTKPKPNSIVELLLTNDWSQALELKLEN-RFPSMPHETVLYVIKRLDKNPEKA 110 Query: 19 LDFFTW 2 FF W Sbjct: 111 SCFFNW 116