BLASTX nr result
ID: Coptis25_contig00042754
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00042754 (217 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI19672.3| unnamed protein product [Vitis vinifera] 72 5e-11 ref|XP_002283027.1| PREDICTED: eukaryotic peptide chain release ... 72 5e-11 ref|XP_002271656.1| PREDICTED: eukaryotic peptide chain release ... 71 1e-10 emb|CAN63440.1| hypothetical protein VITISV_020937 [Vitis vinifera] 71 1e-10 ref|XP_003518164.1| PREDICTED: eukaryotic peptide chain release ... 70 2e-10 >emb|CBI19672.3| unnamed protein product [Vitis vinifera] Length = 430 Score = 72.0 bits (175), Expect = 5e-11 Identities = 35/43 (81%), Positives = 39/43 (90%), Gaps = 2/43 (4%) Frame = +3 Query: 3 LEFVTNKSR--SEFCRGFGGIGGILRYQVDMRSFDELSGDSEH 125 LEFVTNKS+ S+FCRGFGGIGGILRYQ+DMRSFDELS D E+ Sbjct: 383 LEFVTNKSQEGSQFCRGFGGIGGILRYQLDMRSFDELSDDGEN 425 >ref|XP_002283027.1| PREDICTED: eukaryotic peptide chain release factor subunit 1-3 [Vitis vinifera] gi|147780810|emb|CAN77215.1| hypothetical protein VITISV_036372 [Vitis vinifera] Length = 437 Score = 72.0 bits (175), Expect = 5e-11 Identities = 35/43 (81%), Positives = 39/43 (90%), Gaps = 2/43 (4%) Frame = +3 Query: 3 LEFVTNKSR--SEFCRGFGGIGGILRYQVDMRSFDELSGDSEH 125 LEFVTNKS+ S+FCRGFGGIGGILRYQ+DMRSFDELS D E+ Sbjct: 390 LEFVTNKSQEGSQFCRGFGGIGGILRYQLDMRSFDELSDDGEN 432 >ref|XP_002271656.1| PREDICTED: eukaryotic peptide chain release factor subunit 1-3 [Vitis vinifera] Length = 437 Score = 70.9 bits (172), Expect = 1e-10 Identities = 34/43 (79%), Positives = 39/43 (90%), Gaps = 2/43 (4%) Frame = +3 Query: 3 LEFVTNKSR--SEFCRGFGGIGGILRYQVDMRSFDELSGDSEH 125 LEFVTNKS+ S+FCRGFGGIGGILRYQ+DMRSFDE+S D E+ Sbjct: 390 LEFVTNKSQEGSQFCRGFGGIGGILRYQLDMRSFDEVSDDGEN 432 >emb|CAN63440.1| hypothetical protein VITISV_020937 [Vitis vinifera] Length = 437 Score = 70.9 bits (172), Expect = 1e-10 Identities = 34/43 (79%), Positives = 39/43 (90%), Gaps = 2/43 (4%) Frame = +3 Query: 3 LEFVTNKSR--SEFCRGFGGIGGILRYQVDMRSFDELSGDSEH 125 LEFVTNKS+ S+FCRGFGGIGGILRYQ+DMRSFDE+S D E+ Sbjct: 390 LEFVTNKSQEGSQFCRGFGGIGGILRYQLDMRSFDEVSDDGEN 432 >ref|XP_003518164.1| PREDICTED: eukaryotic peptide chain release factor subunit 1-3-like [Glycine max] Length = 437 Score = 70.1 bits (170), Expect = 2e-10 Identities = 34/42 (80%), Positives = 38/42 (90%), Gaps = 2/42 (4%) Frame = +3 Query: 3 LEFVTNKSR--SEFCRGFGGIGGILRYQVDMRSFDELSGDSE 122 LEFVTNKS+ S+FCRGFGGIGGILRYQ+D+RSFDELS D E Sbjct: 390 LEFVTNKSQEGSQFCRGFGGIGGILRYQLDIRSFDELSDDGE 431