BLASTX nr result
ID: Coptis25_contig00042618
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00042618 (404 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI26569.3| unnamed protein product [Vitis vinifera] 58 7e-07 emb|CAN76113.1| hypothetical protein VITISV_005528 [Vitis vinifera] 58 7e-07 ref|XP_002275213.2| PREDICTED: pentatricopeptide repeat-containi... 56 3e-06 ref|XP_004164250.1| PREDICTED: putative pentatricopeptide repeat... 55 8e-06 ref|XP_004146932.1| PREDICTED: putative pentatricopeptide repeat... 55 8e-06 >emb|CBI26569.3| unnamed protein product [Vitis vinifera] Length = 392 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = +2 Query: 2 KIYKEMESVGCTPDRKAREMLQSASMVLEQGHGRQYT*CL 121 +IY+EMES GCTPDRKAREMLQ+A +VL+Q H + Y C+ Sbjct: 350 EIYEEMESAGCTPDRKAREMLQTALLVLQQRHCKYYFGCI 389 >emb|CAN76113.1| hypothetical protein VITISV_005528 [Vitis vinifera] Length = 466 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = +2 Query: 2 KIYKEMESVGCTPDRKAREMLQSASMVLEQGHGRQYT*CL 121 +IY+EMES GCTPDRKAREMLQ+A +VL+Q H + Y C+ Sbjct: 424 EIYEEMESAGCTPDRKAREMLQTALLVLQQRHCKYYFGCI 463 >ref|XP_002275213.2| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Vitis vinifera] Length = 494 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = +2 Query: 2 KIYKEMESVGCTPDRKAREMLQSASMVLEQGHGRQY 109 +IY+EMES GCTPDRKAREMLQ+A +VL+Q H + Y Sbjct: 429 EIYEEMESAGCTPDRKAREMLQTALLVLQQRHCKYY 464 >ref|XP_004164250.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g36300-like [Cucumis sativus] Length = 433 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = +2 Query: 2 KIYKEMESVGCTPDRKAREMLQSASMVLEQGH 97 +IYKEMES GCTPDRKAREML+S + +LEQ H Sbjct: 353 EIYKEMESAGCTPDRKAREMLKSVTAILEQRH 384 >ref|XP_004146932.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g36300-like [Cucumis sativus] Length = 455 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = +2 Query: 2 KIYKEMESVGCTPDRKAREMLQSASMVLEQGH 97 +IYKEMES GCTPDRKAREML+S + +LEQ H Sbjct: 353 EIYKEMESAGCTPDRKAREMLKSVTAILEQRH 384