BLASTX nr result
ID: Coptis25_contig00042394
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00042394 (350 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525601.1| conserved hypothetical protein [Ricinus comm... 58 9e-07 >ref|XP_002525601.1| conserved hypothetical protein [Ricinus communis] gi|223535037|gb|EEF36719.1| conserved hypothetical protein [Ricinus communis] Length = 110 Score = 57.8 bits (138), Expect = 9e-07 Identities = 27/32 (84%), Positives = 27/32 (84%) Frame = -1 Query: 167 PVQAQKKWKTKSTLPTQVLSCSGSKGLSQPVL 72 PVQ QKKWK K TLPTQ LSCSGSKGLSQP L Sbjct: 23 PVQEQKKWKRKCTLPTQALSCSGSKGLSQPDL 54