BLASTX nr result
ID: Coptis25_contig00042388
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00042388 (342 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABD32264.2| RNA-directed DNA polymerase , putative [Medicago ... 55 8e-07 gb|ABN09154.1| RNA-directed DNA polymerase (Reverse transcriptas... 54 5e-06 ref|XP_002522932.1| conserved hypothetical protein [Ricinus comm... 55 8e-06 gb|AAG50886.1|AC025294_24 hypothetical protein [Arabidopsis thal... 41 8e-06 >gb|ABD32264.2| RNA-directed DNA polymerase , putative [Medicago truncatula] Length = 161 Score = 55.1 bits (131), Expect(2) = 8e-07 Identities = 20/48 (41%), Positives = 35/48 (72%), Gaps = 2/48 (4%) Frame = -2 Query: 329 ILIYKWPSAVIK--EGIMRNFVWTGNPLTKRATTVSWKKWCKPVDEGG 192 I +Y WP++++K E ++NF+W+G+ ++ TV+WKK C+P D+GG Sbjct: 92 ITVYNWPTSLLKDLEKSIKNFIWSGDTSKRKLVTVAWKKLCRPFDQGG 139 Score = 22.7 bits (47), Expect(2) = 8e-07 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -3 Query: 196 GVRFRRLKELNVVLLMKLVWRI 131 G+R R L +LN +KL W I Sbjct: 139 GLRIRSLIQLNSASNLKLCWNI 160 >gb|ABN09154.1| RNA-directed DNA polymerase (Reverse transcriptase) [Medicago truncatula] Length = 528 Score = 54.3 bits (129), Expect(2) = 5e-06 Identities = 23/48 (47%), Positives = 32/48 (66%), Gaps = 2/48 (4%) Frame = -2 Query: 329 ILIYKWPSAVIKE--GIMRNFVWTGNPLTKRATTVSWKKWCKPVDEGG 192 I IY WPS ++KE RNF+W+G+ ++ TV+WKK CKP +GG Sbjct: 457 ITIYDWPSFLLKELETCFRNFIWSGDITKRKLVTVAWKKLCKPQSQGG 504 Score = 20.8 bits (42), Expect(2) = 5e-06 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -3 Query: 196 GVRFRRLKELNVVLLMKLVWRIL 128 G+ R L +LN +KL W +L Sbjct: 504 GLGIRSLSQLNAAGNLKLCWDML 526 >ref|XP_002522932.1| conserved hypothetical protein [Ricinus communis] gi|223537826|gb|EEF39443.1| conserved hypothetical protein [Ricinus communis] Length = 303 Score = 54.7 bits (130), Expect = 8e-06 Identities = 22/47 (46%), Positives = 33/47 (70%), Gaps = 2/47 (4%) Frame = -2 Query: 326 LIYKWPSAVIK--EGIMRNFVWTGNPLTKRATTVSWKKWCKPVDEGG 192 ++Y+WPS+++K E +RNF+WTG+ K+ TV W CKP+ EGG Sbjct: 193 MMYRWPSSLLKSIEKAIRNFLWTGSVSYKKLVTVKWGHCCKPISEGG 239 >gb|AAG50886.1|AC025294_24 hypothetical protein [Arabidopsis thaliana] Length = 629 Score = 41.2 bits (95), Expect(2) = 8e-06 Identities = 20/45 (44%), Positives = 26/45 (57%), Gaps = 2/45 (4%) Frame = -2 Query: 320 YKWPSAVIKE--GIMRNFVWTGNPLTKRATTVSWKKWCKPVDEGG 192 ++ PSA +KE I F+W+G L +R VSW CKP EGG Sbjct: 234 FRLPSACLKEINSICSAFLWSGPELHRRKAKVSWDDICKPKQEGG 278 Score = 33.1 bits (74), Expect(2) = 8e-06 Identities = 15/36 (41%), Positives = 24/36 (66%) Frame = -3 Query: 196 GVRFRRLKELNVVLLMKLVWRILTTEDEFVTFIWAK 89 G+ R L E NVV ++KL+WR+ T+ D+ + W+K Sbjct: 278 GLGLRSLTEANVVSVLKLIWRV-TSNDDSLWVKWSK 312