BLASTX nr result
ID: Coptis25_contig00042321
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00042321 (279 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002308338.1| predicted protein [Populus trichocarpa] gi|2... 64 1e-08 ref|XP_002524102.1| conserved hypothetical protein [Ricinus comm... 58 7e-07 >ref|XP_002308338.1| predicted protein [Populus trichocarpa] gi|222854314|gb|EEE91861.1| predicted protein [Populus trichocarpa] Length = 95 Score = 64.3 bits (155), Expect = 1e-08 Identities = 31/46 (67%), Positives = 38/46 (82%), Gaps = 1/46 (2%) Frame = +3 Query: 3 DSFKIKKPHASNQNRP-PVVIHLKSPEIIHIRPQDFMNTVQRLTGK 137 +S KIKK A NQ R PV+++LKSP+IIH+RP+DFM TVQRLTGK Sbjct: 18 NSSKIKKTAAPNQGRSSPVIVYLKSPDIIHVRPEDFMGTVQRLTGK 63 >ref|XP_002524102.1| conserved hypothetical protein [Ricinus communis] gi|223536670|gb|EEF38312.1| conserved hypothetical protein [Ricinus communis] Length = 142 Score = 58.2 bits (139), Expect = 7e-07 Identities = 27/48 (56%), Positives = 35/48 (72%), Gaps = 3/48 (6%) Frame = +3 Query: 3 DSFKIKK---PHASNQNRPPVVIHLKSPEIIHIRPQDFMNTVQRLTGK 137 +S KIKK PH N R PV+I+LKSP++IH+ P++F VQRLTGK Sbjct: 23 NSSKIKKSLLPHPPNHRRSPVIIYLKSPDVIHVTPEEFRGLVQRLTGK 70