BLASTX nr result
ID: Coptis25_contig00042140
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00042140 (277 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004147834.1| PREDICTED: auxin-induced protein 6B-like [Cu... 74 1e-11 emb|CAN60527.1| hypothetical protein VITISV_000524 [Vitis vinifera] 73 3e-11 ref|XP_002277332.1| PREDICTED: auxin-induced protein 6B-like [Vi... 72 5e-11 ref|XP_002510511.1| Auxin-induced protein 6B, putative [Ricinus ... 68 7e-10 ref|XP_003549458.1| PREDICTED: auxin-induced protein 6B-like [Gl... 65 7e-09 >ref|XP_004147834.1| PREDICTED: auxin-induced protein 6B-like [Cucumis sativus] gi|449519840|ref|XP_004166942.1| PREDICTED: auxin-induced protein 6B-like [Cucumis sativus] Length = 150 Score = 73.9 bits (180), Expect = 1e-11 Identities = 32/47 (68%), Positives = 36/47 (76%) Frame = -1 Query: 277 SESSNSARFANFEDFQRYCHVGLRTNLDFWPESRPLLLHGLTENTIW 137 SES NS RF +DFQ YCH+G+RT LD WPESRP LLHGL E +IW Sbjct: 105 SESPNSGRFVKLDDFQSYCHIGIRTGLDLWPESRP-LLHGLAEKSIW 150 >emb|CAN60527.1| hypothetical protein VITISV_000524 [Vitis vinifera] Length = 200 Score = 72.8 bits (177), Expect = 3e-11 Identities = 34/54 (62%), Positives = 40/54 (74%), Gaps = 1/54 (1%) Frame = -1 Query: 277 SESSNSARFANFEDFQRYCHVGLRTNLDFWPESRPLLLH-GLTENTIW*VNRSW 119 SE+SNSARF N EDFQRYCHVG+R++LDFWPESRPLL T +W + W Sbjct: 109 SEASNSARFVNREDFQRYCHVGIRSSLDFWPESRPLLHRVCFTPKNVWRWHIGW 162 >ref|XP_002277332.1| PREDICTED: auxin-induced protein 6B-like [Vitis vinifera] Length = 151 Score = 72.0 bits (175), Expect = 5e-11 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = -1 Query: 277 SESSNSARFANFEDFQRYCHVGLRTNLDFWPESRPLL 167 SE+SNSARF N EDFQRYCHVG+R++LDFWPESRPLL Sbjct: 109 SEASNSARFVNREDFQRYCHVGIRSSLDFWPESRPLL 145 >ref|XP_002510511.1| Auxin-induced protein 6B, putative [Ricinus communis] gi|223551212|gb|EEF52698.1| Auxin-induced protein 6B, putative [Ricinus communis] Length = 151 Score = 68.2 bits (165), Expect = 7e-10 Identities = 33/48 (68%), Positives = 38/48 (79%), Gaps = 1/48 (2%) Frame = -1 Query: 277 SESSNSARFANFEDFQRYCHVGLRTN-LDFWPESRPLLLHGLTENTIW 137 SES NS R N EDFQRYCHVG+R++ LDFW ESRP LL+GL + TIW Sbjct: 105 SESGNSTRLFNLEDFQRYCHVGVRSSKLDFWTESRP-LLNGLADKTIW 151 >ref|XP_003549458.1| PREDICTED: auxin-induced protein 6B-like [Glycine max] Length = 151 Score = 64.7 bits (156), Expect = 7e-09 Identities = 33/50 (66%), Positives = 37/50 (74%), Gaps = 3/50 (6%) Frame = -1 Query: 277 SESSNSARFANFE--DFQR-YCHVGLRTNLDFWPESRPLLLHGLTENTIW 137 S+ + S RF N E DFQR YCHVG+ NLDFWPESRP LLHG T+ TIW Sbjct: 103 SDPAKSNRFLNLELDDFQRHYCHVGISNNLDFWPESRP-LLHGPTDKTIW 151