BLASTX nr result
ID: Coptis25_contig00041592
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00041592 (484 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_848429.1| cathepsin [Choristoneura fumiferana MNPV] gi|11... 55 4e-06 ref|XP_003093674.1| hypothetical protein CRE_29187 [Caenorhabdit... 54 1e-05 gb|AAB68595.1| cathepsin [Choristoneura fumiferana MNPV] 54 1e-05 >ref|NP_848429.1| cathepsin [Choristoneura fumiferana MNPV] gi|1168799|sp|P41715.1|CATV_NPVCF RecName: Full=Viral cathepsin; Short=V-cath; AltName: Full=Cysteine proteinase; Short=CP; Flags: Precursor gi|332509|gb|AAA96732.1| cathepsin [Choristoneura fumiferana MNPV] gi|30270084|gb|AAP29900.1| cathepsin [Choristoneura fumiferana MNPV] Length = 324 Score = 55.5 bits (132), Expect = 4e-06 Identities = 31/73 (42%), Positives = 42/73 (57%), Gaps = 4/73 (5%) Frame = +2 Query: 98 IRSQSEITYQQKLSQIENEKRGL-KYRLKR---HALVLIGYGEEKGVPFYIAQNSYGLCW 265 +RS I S I N KRG+ KY HA++L+GY E GVPF+I +N++G W Sbjct: 237 LRSVGPIPVAIDASDIVNYKRGIMKYCANHGLNHAVLLVGYAVENGVPFWILKNTWGADW 296 Query: 266 GEEGCLRLDQRGN 304 GE+G R+ Q N Sbjct: 297 GEQGYFRVQQNIN 309 >ref|XP_003093674.1| hypothetical protein CRE_29187 [Caenorhabditis remanei] gi|308249538|gb|EFO93490.1| hypothetical protein CRE_29187 [Caenorhabditis remanei] Length = 392 Score = 54.3 bits (129), Expect = 1e-05 Identities = 24/51 (47%), Positives = 34/51 (66%) Frame = +2 Query: 185 HALVLIGYGEEKGVPFYIAQNSYGLCWGEEGCLRLDQRGNIGRMREKVVRP 337 HA+ LIGYG E P++I +NS+G WG++G +RL + N MR+ VV P Sbjct: 339 HAMTLIGYGTEGNQPYWIVKNSWGSSWGDQGYMRLARGNNACGMRDFVVAP 389 >gb|AAB68595.1| cathepsin [Choristoneura fumiferana MNPV] Length = 324 Score = 54.3 bits (129), Expect = 1e-05 Identities = 30/73 (41%), Positives = 42/73 (57%), Gaps = 4/73 (5%) Frame = +2 Query: 98 IRSQSEITYQQKLSQIENEKRGL-KYRLKR---HALVLIGYGEEKGVPFYIAQNSYGLCW 265 +RS I S I N KRG+ KY HA++L+GY + GVPF+I +N++G W Sbjct: 237 LRSVGPIPVAIDASDIVNYKRGIMKYCANHGLNHAVLLVGYAVQNGVPFWILKNTWGADW 296 Query: 266 GEEGCLRLDQRGN 304 GE+G R+ Q N Sbjct: 297 GEQGYFRVQQNIN 309