BLASTX nr result
ID: Coptis25_contig00041509
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00041509 (281 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002262875.2| PREDICTED: probable glucan 1,3-beta-glucosid... 74 2e-11 emb|CBI33153.3| unnamed protein product [Vitis vinifera] 74 2e-11 ref|XP_004143452.1| PREDICTED: probable glucan 1,3-beta-glucosid... 70 2e-10 ref|XP_002533566.1| conserved hypothetical protein [Ricinus comm... 65 6e-09 ref|XP_003601915.1| Glucan 1,3-beta-glucosidase [Medicago trunca... 62 5e-08 >ref|XP_002262875.2| PREDICTED: probable glucan 1,3-beta-glucosidase A-like [Vitis vinifera] Length = 539 Score = 73.6 bits (179), Expect = 2e-11 Identities = 31/45 (68%), Positives = 35/45 (77%) Frame = -1 Query: 281 WTLKNDRKHWDFEWNIQNGYLQLGDSPNKNIPSIAQLLALSCWML 147 WTLKNDRKHWDFEWNI+N YLQLG SPN+ + + A LL L C L Sbjct: 489 WTLKNDRKHWDFEWNIRNNYLQLGSSPNRQVSNSAVLLGLVCGYL 533 >emb|CBI33153.3| unnamed protein product [Vitis vinifera] Length = 592 Score = 73.6 bits (179), Expect = 2e-11 Identities = 31/45 (68%), Positives = 35/45 (77%) Frame = -1 Query: 281 WTLKNDRKHWDFEWNIQNGYLQLGDSPNKNIPSIAQLLALSCWML 147 WTLKNDRKHWDFEWNI+N YLQLG SPN+ + + A LL L C L Sbjct: 542 WTLKNDRKHWDFEWNIRNNYLQLGSSPNRQVSNSAVLLGLVCGYL 586 >ref|XP_004143452.1| PREDICTED: probable glucan 1,3-beta-glucosidase A-like [Cucumis sativus] Length = 530 Score = 69.7 bits (169), Expect = 2e-10 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = -1 Query: 281 WTLKNDRKHWDFEWNIQNGYLQLGDSPNKNIPSIAQLLALSC 156 WTLKNDRKHWDFEWNI+N YLQ GDSP++ I + L+AL+C Sbjct: 479 WTLKNDRKHWDFEWNIKNNYLQFGDSPSRVIFNCYLLVALAC 520 >ref|XP_002533566.1| conserved hypothetical protein [Ricinus communis] gi|223526566|gb|EEF28823.1| conserved hypothetical protein [Ricinus communis] Length = 515 Score = 65.1 bits (157), Expect = 6e-09 Identities = 30/47 (63%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = -1 Query: 281 WTLKNDRKHWDFEWNIQNGYLQLGDSPNKNIPSIAQLLAL--SCWML 147 WTLKNDRKHWDFEWNI+N YLQ G+SP K I + LL L +C+ L Sbjct: 465 WTLKNDRKHWDFEWNIRNRYLQFGNSPAKEIFNRVALLGLVSTCFFL 511 >ref|XP_003601915.1| Glucan 1,3-beta-glucosidase [Medicago truncatula] gi|355490963|gb|AES72166.1| Glucan 1,3-beta-glucosidase [Medicago truncatula] Length = 533 Score = 62.0 bits (149), Expect = 5e-08 Identities = 24/28 (85%), Positives = 26/28 (92%) Frame = -1 Query: 281 WTLKNDRKHWDFEWNIQNGYLQLGDSPN 198 WTLKNDR HWDFEWNI+N YLQLG+SPN Sbjct: 483 WTLKNDRDHWDFEWNIRNNYLQLGNSPN 510