BLASTX nr result
ID: Coptis25_contig00041483
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00041483 (347 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531408.1| conserved hypothetical protein [Ricinus comm... 60 2e-07 ref|XP_002266853.1| PREDICTED: uncharacterized protein LOC100251... 55 8e-06 >ref|XP_002531408.1| conserved hypothetical protein [Ricinus communis] gi|223529001|gb|EEF30992.1| conserved hypothetical protein [Ricinus communis] Length = 162 Score = 59.7 bits (143), Expect = 2e-07 Identities = 34/59 (57%), Positives = 42/59 (71%), Gaps = 1/59 (1%) Frame = -2 Query: 178 KAISSNTLLLNDTSTQCKYVYPDPVPEFAQTETLKFRSELRKNLWTNKE-FGDDLDKVV 5 K ISSNT+ T + YVY DP+PEFAQ+ET KFR+E+ K L +K+ FG DLDKVV Sbjct: 37 KPISSNTV--GATPSFQNYVYSDPIPEFAQSETEKFRAEILKKLSKDKQTFGGDLDKVV 93 >ref|XP_002266853.1| PREDICTED: uncharacterized protein LOC100251854 [Vitis vinifera] gi|296086501|emb|CBI32090.3| unnamed protein product [Vitis vinifera] Length = 188 Score = 54.7 bits (130), Expect = 8e-06 Identities = 29/47 (61%), Positives = 33/47 (70%), Gaps = 1/47 (2%) Frame = -2 Query: 139 STQCKYVYPDPVPEFAQTETLKFRSELRKNLWTNKE-FGDDLDKVVS 2 ST KYVYPDP+PEFA+ ET KFR EL K L K+ F DDL VV+ Sbjct: 72 STPQKYVYPDPIPEFAEAETEKFRVELLKKLSKEKDTFRDDLHAVVA 118