BLASTX nr result
ID: Coptis25_contig00041405
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00041405 (245 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI30307.3| unnamed protein product [Vitis vinifera] 66 3e-09 ref|XP_002276489.1| PREDICTED: ABC transporter B family member 2... 66 3e-09 ref|XP_004149200.1| PREDICTED: ABC transporter B family member 2... 58 7e-07 ref|XP_002530326.1| abc transporter, putative [Ricinus communis]... 55 6e-06 ref|XP_002308470.1| ABC transporter family, retinal flippase sub... 55 8e-06 >emb|CBI30307.3| unnamed protein product [Vitis vinifera] Length = 723 Score = 66.2 bits (160), Expect = 3e-09 Identities = 27/46 (58%), Positives = 39/46 (84%) Frame = -3 Query: 192 QPIKPYIISEWKSIIKGWICSMISVYCLSILVPRVGKFSSVLSVVN 55 + IKPY++SE+K I+KGW CS++SVY LS +VP+VGKFS+ LS ++ Sbjct: 155 EAIKPYVLSEYKPILKGWFCSLVSVYSLSKIVPKVGKFSATLSKID 200 >ref|XP_002276489.1| PREDICTED: ABC transporter B family member 29, chloroplastic [Vitis vinifera] Length = 630 Score = 66.2 bits (160), Expect = 3e-09 Identities = 27/46 (58%), Positives = 39/46 (84%) Frame = -3 Query: 192 QPIKPYIISEWKSIIKGWICSMISVYCLSILVPRVGKFSSVLSVVN 55 + IKPY++SE+K I+KGW CS++SVY LS +VP+VGKFS+ LS ++ Sbjct: 61 EAIKPYVLSEYKPILKGWFCSLVSVYSLSKIVPKVGKFSATLSKID 106 >ref|XP_004149200.1| PREDICTED: ABC transporter B family member 29, chloroplastic-like [Cucumis sativus] gi|449522662|ref|XP_004168345.1| PREDICTED: ABC transporter B family member 29, chloroplastic-like [Cucumis sativus] Length = 643 Score = 58.2 bits (139), Expect = 7e-07 Identities = 22/42 (52%), Positives = 36/42 (85%) Frame = -3 Query: 180 PYIISEWKSIIKGWICSMISVYCLSILVPRVGKFSSVLSVVN 55 PYI+S+ K I+ GW+CS++SV+ LS++VP++GKFSS++ V+ Sbjct: 80 PYILSQRKHILAGWLCSVVSVFSLSLIVPKIGKFSSIIDKVD 121 >ref|XP_002530326.1| abc transporter, putative [Ricinus communis] gi|223530130|gb|EEF32042.1| abc transporter, putative [Ricinus communis] Length = 650 Score = 55.1 bits (131), Expect = 6e-06 Identities = 23/47 (48%), Positives = 37/47 (78%) Frame = -3 Query: 186 IKPYIISEWKSIIKGWICSMISVYCLSILVPRVGKFSSVLSVVNMNR 46 IKPY++S+ K+I+ GW+CS+ISV LS +VPR+G+FS+ + ++ R Sbjct: 82 IKPYVLSQQKTILLGWLCSVISVLSLSQIVPRIGQFSANIGKIDALR 128 >ref|XP_002308470.1| ABC transporter family, retinal flippase subfamily [Populus trichocarpa] gi|222854446|gb|EEE91993.1| ABC transporter family, retinal flippase subfamily [Populus trichocarpa] Length = 570 Score = 54.7 bits (130), Expect = 8e-06 Identities = 23/44 (52%), Positives = 34/44 (77%) Frame = -3 Query: 186 IKPYIISEWKSIIKGWICSMISVYCLSILVPRVGKFSSVLSVVN 55 IKP+I S++K I+ GW+CS++SV LS LVP+ G+FSS + +N Sbjct: 4 IKPFIFSQYKPILLGWLCSLLSVLSLSQLVPKFGQFSSSIGKIN 47