BLASTX nr result
ID: Coptis25_contig00041240
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00041240 (337 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003615696.1| Pentatricopeptide repeat-containing protein ... 57 1e-06 ref|NP_173402.2| pentatricopeptide repeat-containing protein [Ar... 57 2e-06 emb|CAA06829.1| DYW7 protein [Arabidopsis thaliana] 57 2e-06 ref|XP_003533423.1| PREDICTED: pentatricopeptide repeat-containi... 56 3e-06 gb|AFG48749.1| Pinus taeda anonymous locus 0_2087_01 genomic seq... 55 8e-06 >ref|XP_003615696.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355517031|gb|AES98654.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 887 Score = 57.4 bits (137), Expect = 1e-06 Identities = 23/33 (69%), Positives = 26/33 (78%) Frame = +3 Query: 3 KFISLRYGRDIYLYDSKRLHHFKNGQCSCRDYW 101 K+IS+ YG +IYL DS LHHFK G CSCRDYW Sbjct: 855 KYISMAYGCEIYLSDSNCLHHFKGGHCSCRDYW 887 >ref|NP_173402.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75263158|sp|Q9FXH1.1|PPR52_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g19720; AltName: Full=Protein DYW7 gi|10086495|gb|AAG12555.1|AC007797_15 Unknown Protein [Arabidopsis thaliana] gi|332191770|gb|AEE29891.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 894 Score = 57.0 bits (136), Expect = 2e-06 Identities = 22/33 (66%), Positives = 27/33 (81%) Frame = +3 Query: 3 KFISLRYGRDIYLYDSKRLHHFKNGQCSCRDYW 101 K++S RYG DI L D++ LHHFKNG CSC+DYW Sbjct: 862 KYVSKRYGCDILLEDTRCLHHFKNGDCSCKDYW 894 >emb|CAA06829.1| DYW7 protein [Arabidopsis thaliana] Length = 406 Score = 57.0 bits (136), Expect = 2e-06 Identities = 22/33 (66%), Positives = 27/33 (81%) Frame = +3 Query: 3 KFISLRYGRDIYLYDSKRLHHFKNGQCSCRDYW 101 K++S RYG DI L D++ LHHFKNG CSC+DYW Sbjct: 374 KYVSKRYGCDILLEDTRCLHHFKNGDCSCKDYW 406 >ref|XP_003533423.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65570-like [Glycine max] Length = 676 Score = 56.2 bits (134), Expect = 3e-06 Identities = 23/33 (69%), Positives = 25/33 (75%) Frame = +3 Query: 3 KFISLRYGRDIYLYDSKRLHHFKNGQCSCRDYW 101 KF+SL GRDI DSKR HHFK G CSC+DYW Sbjct: 644 KFVSLLTGRDIIARDSKRFHHFKGGLCSCKDYW 676 >gb|AFG48749.1| Pinus taeda anonymous locus 0_2087_01 genomic sequence Length = 95 Score = 54.7 bits (130), Expect = 8e-06 Identities = 22/33 (66%), Positives = 27/33 (81%) Frame = +3 Query: 3 KFISLRYGRDIYLYDSKRLHHFKNGQCSCRDYW 101 KFIS Y R+I L D+KR HHFK+GQCSCR++W Sbjct: 63 KFISKVYEREIILRDTKRFHHFKDGQCSCREFW 95