BLASTX nr result
ID: Coptis25_contig00041197
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00041197 (257 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003604154.1| Ycf68 protein [Medicago truncatula] gi|35550... 100 1e-19 ref|XP_003599576.1| Ycf68 protein [Medicago truncatula] gi|35548... 100 1e-19 ref|XP_003610227.1| Ycf68 [Medicago truncatula] gi|355511282|gb|... 64 9e-19 ref|YP_636345.1| hypothetical protein EuglglCp070 [Eucalyptus gl... 97 2e-18 ref|XP_002863307.1| predicted protein [Arabidopsis lyrata subsp.... 77 2e-12 >ref|XP_003604154.1| Ycf68 protein [Medicago truncatula] gi|355505209|gb|AES86351.1| Ycf68 protein [Medicago truncatula] Length = 237 Score = 100 bits (249), Expect = 1e-19 Identities = 51/71 (71%), Positives = 53/71 (74%) Frame = -1 Query: 215 RALSHMDSSMCSSAPDPEMWIIQGTLAWRTPPVRTGV*NQTSPQEDRWGDSGEIQCRSNF 36 RALSH+DSSMCSSAPDPEMWIIQGTL EDRWGDSGEIQCRSNF Sbjct: 119 RALSHIDSSMCSSAPDPEMWIIQGTL------------------EDRWGDSGEIQCRSNF 160 Query: 35 LFTRGIRAVRG 3 LFTRGIRAV+G Sbjct: 161 LFTRGIRAVQG 171 >ref|XP_003599576.1| Ycf68 protein [Medicago truncatula] gi|355488624|gb|AES69827.1| Ycf68 protein [Medicago truncatula] Length = 237 Score = 100 bits (249), Expect = 1e-19 Identities = 51/71 (71%), Positives = 53/71 (74%) Frame = -1 Query: 215 RALSHMDSSMCSSAPDPEMWIIQGTLAWRTPPVRTGV*NQTSPQEDRWGDSGEIQCRSNF 36 RALSH+DSSMCSSAPDPEMWIIQGTL EDRWGDSGEIQCRSNF Sbjct: 119 RALSHIDSSMCSSAPDPEMWIIQGTL------------------EDRWGDSGEIQCRSNF 160 Query: 35 LFTRGIRAVRG 3 LFTRGIRAV+G Sbjct: 161 LFTRGIRAVQG 171 >ref|XP_003610227.1| Ycf68 [Medicago truncatula] gi|355511282|gb|AES92424.1| Ycf68 [Medicago truncatula] Length = 501 Score = 63.9 bits (154), Expect(2) = 9e-19 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 218 VRALSHMDSSMCSSAPDPEMWIIQGTLAWR 129 V ALSH+DSSMCSSAPDPEMWIIQGTLAWR Sbjct: 407 VEALSHIDSSMCSSAPDPEMWIIQGTLAWR 436 Score = 54.3 bits (129), Expect(2) = 9e-19 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = -2 Query: 82 RIDGAIQVRSNVDPTFYSLVGSGRSGG 2 RIDGAIQVRSNVDPTFYSLVGSGRS G Sbjct: 436 RIDGAIQVRSNVDPTFYSLVGSGRSRG 462 >ref|YP_636345.1| hypothetical protein EuglglCp070 [Eucalyptus globulus subsp. globulus] gi|108802701|ref|YP_636358.1| hypothetical protein EuglglCp084 [Eucalyptus globulus subsp. globulus] gi|122219157|sp|Q49KT9.1|YCF68_EUCGG RecName: Full=Uncharacterized protein ycf68; AltName: Full=ORF113 gi|60460854|gb|AAX21074.1| hypothetical protein [Eucalyptus globulus subsp. globulus] gi|60460867|gb|AAX21087.1| hypothetical protein [Eucalyptus globulus subsp. globulus] Length = 113 Score = 96.7 bits (239), Expect = 2e-18 Identities = 50/67 (74%), Positives = 52/67 (77%) Frame = -1 Query: 239 LRHCAWAVRALSHMDSSMCSSAPDPEMWIIQGTLAWRTPPVRTGV*NQTSPQEDRWGDSG 60 +R CAWAVRALSHMDSSMCSSAPDPEMWIIQGTLAWRT PVRTG +T P R G Sbjct: 1 MRRCAWAVRALSHMDSSMCSSAPDPEMWIIQGTLAWRTSPVRTGF--ETKPLLRR--IDG 56 Query: 59 EIQCRSN 39 IQ RSN Sbjct: 57 AIQVRSN 63 Score = 69.3 bits (168), Expect = 3e-10 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = -2 Query: 106 FETKLLLRRIDGAIQVRSNVDPTFYSLVGSGRSGG 2 FETK LLRRIDGAIQVRSNVDPTFYSLVGSGRSGG Sbjct: 45 FETKPLLRRIDGAIQVRSNVDPTFYSLVGSGRSGG 79 >ref|XP_002863307.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297309141|gb|EFH39566.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 90 Score = 76.6 bits (187), Expect = 2e-12 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = -1 Query: 209 LSHMDSSMCSSAPDPEMWIIQGTLAWRTPPVRTGV 105 ++HMDSSMCSSAPDPEMWIIQGTLAWRTPPVRTGV Sbjct: 56 VNHMDSSMCSSAPDPEMWIIQGTLAWRTPPVRTGV 90