BLASTX nr result
ID: Coptis25_contig00041076
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00041076 (314 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAF17675.1|AC009243_2 F28K19.3 [Arabidopsis thaliana] 44 2e-06 >gb|AAF17675.1|AC009243_2 F28K19.3 [Arabidopsis thaliana] Length = 238 Score = 44.3 bits (103), Expect(2) = 2e-06 Identities = 20/49 (40%), Positives = 27/49 (55%) Frame = +2 Query: 140 VCLSETKVDNDSISRLGKAIKFDNCFFVPAASLSGGLAILWKEGCELEI 286 +CLSETK ND + + F N VP+ LSGGL +LWK + + Sbjct: 85 ICLSETKQRNDYVRDTCCELGFSNFVMVPSMGLSGGLVVLWKPSVHISV 133 Score = 32.0 bits (71), Expect(2) = 2e-06 Identities = 9/27 (33%), Positives = 20/27 (74%) Frame = +1 Query: 58 NCRGIGSSTAIQHLKDLIQQHQPDIVC 138 NC+G+G ++ LK++ +++ PD++C Sbjct: 60 NCQGLGIDLTVRRLKEINRKYLPDVIC 86