BLASTX nr result
ID: Coptis25_contig00041042
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00041042 (201 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524633.1| Cyclic nucleotide-gated ion channel, putativ... 58 7e-07 ref|XP_003529780.1| PREDICTED: probable cyclic nucleotide-gated ... 57 2e-06 ref|XP_003534111.1| PREDICTED: probable cyclic nucleotide-gated ... 55 6e-06 ref|XP_003548315.1| PREDICTED: probable cyclic nucleotide-gated ... 55 6e-06 >ref|XP_002524633.1| Cyclic nucleotide-gated ion channel, putative [Ricinus communis] gi|223536102|gb|EEF37758.1| Cyclic nucleotide-gated ion channel, putative [Ricinus communis] Length = 778 Score = 58.2 bits (139), Expect = 7e-07 Identities = 28/52 (53%), Positives = 38/52 (73%) Frame = +2 Query: 41 MAPSENEEIPMLSSIRSQLSDEHMDNEPQRFSSRTRSASMSIPMYAMDSYGS 196 MA + +E+PMLS + QL DE+ D+ Q F SRT+SAS+SIPM M+SYG+ Sbjct: 1 MASYDKDEVPMLSDVHPQLLDENPDSRFQAFVSRTQSASISIPMNTMESYGN 52 >ref|XP_003529780.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic-like [Glycine max] Length = 217 Score = 56.6 bits (135), Expect = 2e-06 Identities = 28/50 (56%), Positives = 38/50 (76%) Frame = +2 Query: 41 MAPSENEEIPMLSSIRSQLSDEHMDNEPQRFSSRTRSASMSIPMYAMDSY 190 MA E +E+PMLS +QLSDE +D+ +R SRTRSAS+SIPM +++SY Sbjct: 1 MAHFEKDEVPMLSETHAQLSDEVVDSSFRRLVSRTRSASISIPMASLESY 50 >ref|XP_003534111.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic-like [Glycine max] Length = 770 Score = 55.1 bits (131), Expect = 6e-06 Identities = 27/50 (54%), Positives = 38/50 (76%) Frame = +2 Query: 41 MAPSENEEIPMLSSIRSQLSDEHMDNEPQRFSSRTRSASMSIPMYAMDSY 190 MA E +E+PMLS +QLSDE +D+ +R SRT+SAS+SIPM +++SY Sbjct: 1 MAHFEKDEVPMLSETHAQLSDEVVDSNFRRLVSRTQSASISIPMASLESY 50 >ref|XP_003548315.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic-like [Glycine max] Length = 772 Score = 55.1 bits (131), Expect = 6e-06 Identities = 27/50 (54%), Positives = 38/50 (76%) Frame = +2 Query: 41 MAPSENEEIPMLSSIRSQLSDEHMDNEPQRFSSRTRSASMSIPMYAMDSY 190 MA E +E+PMLS ++LSDE +D+ +R SRTRSAS+SIPM +++SY Sbjct: 1 MAHFEKDEVPMLSETHARLSDEVVDSNFRRLVSRTRSASISIPMASLESY 50