BLASTX nr result
ID: Coptis25_contig00041040
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00041040 (308 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN80507.1| hypothetical protein VITISV_025269 [Vitis vinifera] 57 2e-06 >emb|CAN80507.1| hypothetical protein VITISV_025269 [Vitis vinifera] Length = 916 Score = 56.6 bits (135), Expect = 2e-06 Identities = 37/113 (32%), Positives = 61/113 (53%), Gaps = 13/113 (11%) Frame = -1 Query: 305 EVEIDPVIVETEAHDPDVSETVVHD-----ISPSTSITEDLDQNAPPQVPPITFNESVGV 141 E+++ +E ++D +E V+ + I PS+ + +N ++P N+S V Sbjct: 400 ELDMSGTTLEPSSNDHTETEEVIEEGRDNTIEPSSPSEQFGSENVFTEIP----NQSSSV 455 Query: 140 E---SLEP-----RQSQRASKGVPKKQYEPDIKATAKYPIANSMSNHSLSESH 6 E +LEP R S R ++G+ K YEP++ KYPI+N +SNH LSES+ Sbjct: 456 EGVLNLEPDPFMKRLSHRHNRGISKPTYEPELSTKVKYPISNYVSNHRLSESN 508