BLASTX nr result
ID: Coptis25_contig00040996
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00040996 (245 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521858.1| pentatricopeptide repeat-containing protein,... 102 4e-20 ref|XP_003631674.1| PREDICTED: pentatricopeptide repeat-containi... 100 2e-19 ref|XP_002313097.1| predicted protein [Populus trichocarpa] gi|2... 97 1e-18 ref|XP_003556634.1| PREDICTED: pentatricopeptide repeat-containi... 94 9e-18 ref|XP_004159923.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 85 7e-15 >ref|XP_002521858.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223538896|gb|EEF40494.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 533 Score = 102 bits (253), Expect = 4e-20 Identities = 47/67 (70%), Positives = 59/67 (88%) Frame = -1 Query: 245 AVTKSLFAEGMDKELGQVIRDVLKSCKLNDAEIAKVLVEVNEKEGNMDAVFNVLTEMAKD 66 A+ K+LF EGMD EL +VI D+L+SCKL DAE++KVLVE+N+KEGNMD VFN+LTEMAKD Sbjct: 458 ALVKALFTEGMDGELNEVIGDILRSCKLTDAELSKVLVEINQKEGNMDMVFNLLTEMAKD 517 Query: 65 GLLPYSG 45 GL+P +G Sbjct: 518 GLIPSTG 524 >ref|XP_003631674.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like [Vitis vinifera] Length = 762 Score = 100 bits (248), Expect = 2e-19 Identities = 46/70 (65%), Positives = 60/70 (85%) Frame = -1 Query: 236 KSLFAEGMDKELGQVIRDVLKSCKLNDAEIAKVLVEVNEKEGNMDAVFNVLTEMAKDGLL 57 K+LF EGM++E+ +VI D L+SC+LN+AE+AKVLVE+N KEGNM+AV NVLT+MAKDGLL Sbjct: 692 KALFKEGMNEEMSEVIGDTLRSCRLNEAELAKVLVEINHKEGNMEAVLNVLTDMAKDGLL 751 Query: 56 PYSGRNVISG 27 P SG+ +G Sbjct: 752 PNSGKTAYAG 761 >ref|XP_002313097.1| predicted protein [Populus trichocarpa] gi|222849505|gb|EEE87052.1| predicted protein [Populus trichocarpa] Length = 751 Score = 97.1 bits (240), Expect = 1e-18 Identities = 43/64 (67%), Positives = 58/64 (90%) Frame = -1 Query: 245 AVTKSLFAEGMDKELGQVIRDVLKSCKLNDAEIAKVLVEVNEKEGNMDAVFNVLTEMAKD 66 A+ K+L++EGMD++L VIRD+L+SCKL+DAE++K LV++N KEGN+DAVFN+LTEMAKD Sbjct: 678 ALVKALYSEGMDEQLNLVIRDILRSCKLSDAELSKALVQINHKEGNIDAVFNLLTEMAKD 737 Query: 65 GLLP 54 G LP Sbjct: 738 GFLP 741 >ref|XP_003556634.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like [Glycine max] Length = 757 Score = 94.4 bits (233), Expect = 9e-18 Identities = 45/67 (67%), Positives = 58/67 (86%) Frame = -1 Query: 245 AVTKSLFAEGMDKELGQVIRDVLKSCKLNDAEIAKVLVEVNEKEGNMDAVFNVLTEMAKD 66 A+ K+L EGM+ EL ++++++L+SC+LNDA++AKVLVEVN KEGNMDAV NVLTEMAKD Sbjct: 682 ALVKALAREGMNDELSRLLQNILRSCRLNDAKVAKVLVEVNFKEGNMDAVLNVLTEMAKD 741 Query: 65 GLLPYSG 45 GLLP G Sbjct: 742 GLLPDGG 748 >ref|XP_004159923.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At5g39710-like [Cucumis sativus] Length = 749 Score = 84.7 bits (208), Expect = 7e-15 Identities = 40/70 (57%), Positives = 53/70 (75%) Frame = -1 Query: 245 AVTKSLFAEGMDKELGQVIRDVLKSCKLNDAEIAKVLVEVNEKEGNMDAVFNVLTEMAKD 66 A+ KSL+ EG + EL Q++ LKSC++ +A +AKVL+ +N KEGNMDAVFNVL +MA Sbjct: 678 ALAKSLYHEGKEVELNQLLDYTLKSCRITEAALAKVLIGINSKEGNMDAVFNVLKDMALS 737 Query: 65 GLLPYSGRNV 36 GLLPYS N+ Sbjct: 738 GLLPYSSANL 747