BLASTX nr result
ID: Coptis25_contig00040692
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00040692 (549 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516415.1| conserved hypothetical protein [Ricinus comm... 59 5e-07 >ref|XP_002516415.1| conserved hypothetical protein [Ricinus communis] gi|223544450|gb|EEF45970.1| conserved hypothetical protein [Ricinus communis] Length = 263 Score = 58.9 bits (141), Expect = 5e-07 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 1/39 (2%) Frame = -1 Query: 273 MDPTTDFTNTQPYVSSPFTLPPFDSLAPLPLPQNT-PYC 160 MDP+ NT PYVSSPFTLPP+DSL+P+PLP+N PYC Sbjct: 1 MDPS----NTDPYVSSPFTLPPYDSLSPIPLPENAPPYC 35