BLASTX nr result
ID: Coptis25_contig00040507
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00040507 (325 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002268526.2| PREDICTED: pentatricopeptide repeat-containi... 55 8e-06 >ref|XP_002268526.2| PREDICTED: pentatricopeptide repeat-containing protein At5g62370-like [Vitis vinifera] Length = 1101 Score = 54.7 bits (130), Expect = 8e-06 Identities = 30/84 (35%), Positives = 47/84 (55%), Gaps = 12/84 (14%) Frame = -3 Query: 248 ILSRGIVP-------LLLCYRLW*YV--IVVYVDGLFRIGSLP---ACNVLLNGLCTEER 105 +++RGI+P +++CY + + + D LF + S P ACN +L LC ER Sbjct: 119 VIARGIIPDSETLNSMVICYCNLGKLEEAMAHFDRLFEVDSFPCKPACNAMLRELCARER 178 Query: 104 VLEAFTIFNKMVSVVVYLSLWCYN 33 VLEAF F ++ V + + LWC+N Sbjct: 179 VLEAFDYFVRINDVGILMGLWCFN 202