BLASTX nr result
ID: Coptis25_contig00040477
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00040477 (291 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|ZP_09149707.1| hypothetical protein HMPREF9473_01769, partia... 56 3e-06 >ref|ZP_09149707.1| hypothetical protein HMPREF9473_01769, partial [Clostridium hathewayi WAL-18680] gi|356698710|gb|EHI60245.1| hypothetical protein HMPREF9473_01769, partial [Clostridium hathewayi WAL-18680] Length = 1951 Score = 56.2 bits (134), Expect = 3e-06 Identities = 37/87 (42%), Positives = 48/87 (55%) Frame = -3 Query: 265 SALRHSEFLQKVSAQRLGNELAKPSETESAQLSEIESAQALEIEPGQPSETESTKLSEVV 86 S L ++ S+Q E +P ETESAQ SE ES + E E QP+ETEST Sbjct: 236 SELEAGPGVETESSQPSKPESTQPVETESAQASEAESTHSSEPESTQPAETEST------ 289 Query: 85 LLQRLEIETTQPSKTKPNQQSEIESAQ 5 Q E E+T+PS+ +P Q SE ES + Sbjct: 290 --QATEAESTRPSEMEPPQSSEPESTR 314