BLASTX nr result
ID: Coptis25_contig00040418
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00040418 (311 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528143.1| pentatricopeptide repeat-containing protein,... 74 2e-11 ref|XP_002304600.1| predicted protein [Populus trichocarpa] gi|2... 70 2e-10 ref|XP_002297917.1| predicted protein [Populus trichocarpa] gi|2... 68 7e-10 ref|XP_002275605.1| PREDICTED: pentatricopeptide repeat-containi... 67 1e-09 emb|CBI27232.3| unnamed protein product [Vitis vinifera] 67 1e-09 >ref|XP_002528143.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223532441|gb|EEF34234.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 653 Score = 73.6 bits (179), Expect = 2e-11 Identities = 35/55 (63%), Positives = 45/55 (81%) Frame = -3 Query: 309 QLVKRRRIFAASKIVEVMLQKYFSPKASTWGRVVKDLCRHRKVQAGIELCRSKLF 145 +L+KR+R ASKIVEVMLQK+ SPKASTW RVV +LC+ +K+QA I+ C SKL+ Sbjct: 598 RLLKRQRNLGASKIVEVMLQKFLSPKASTWARVVHELCQPKKIQAVIDKCWSKLY 652 >ref|XP_002304600.1| predicted protein [Populus trichocarpa] gi|222842032|gb|EEE79579.1| predicted protein [Populus trichocarpa] Length = 641 Score = 70.1 bits (170), Expect = 2e-10 Identities = 34/55 (61%), Positives = 42/55 (76%) Frame = -3 Query: 309 QLVKRRRIFAASKIVEVMLQKYFSPKASTWGRVVKDLCRHRKVQAGIELCRSKLF 145 +L+KR+R+ ASKIVEVMLQK PK STW RVV+DLC +KVQA I+ C S L+ Sbjct: 586 RLLKRQRVLGASKIVEVMLQKLLPPKPSTWTRVVEDLCNPKKVQAAIQKCWSILY 640 >ref|XP_002297917.1| predicted protein [Populus trichocarpa] gi|222845175|gb|EEE82722.1| predicted protein [Populus trichocarpa] Length = 670 Score = 68.2 bits (165), Expect = 7e-10 Identities = 33/55 (60%), Positives = 43/55 (78%) Frame = -3 Query: 309 QLVKRRRIFAASKIVEVMLQKYFSPKASTWGRVVKDLCRHRKVQAGIELCRSKLF 145 +L+KR+R+ ASKIVEVMLQK PK STW RVV++LC+ +KVQA I+ C S L+ Sbjct: 616 RLLKRQRVLGASKIVEVMLQKLLPPKHSTWARVVENLCKPKKVQAVIQKCWSILY 670 >ref|XP_002275605.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20090-like [Vitis vinifera] Length = 644 Score = 67.0 bits (162), Expect = 1e-09 Identities = 31/55 (56%), Positives = 42/55 (76%) Frame = -3 Query: 309 QLVKRRRIFAASKIVEVMLQKYFSPKASTWGRVVKDLCRHRKVQAGIELCRSKLF 145 +L KR+RI A+KI+EVMLQK+ P ASTW R++ +LC+ +KVQA I+ C S LF Sbjct: 589 RLHKRQRIVGAAKIIEVMLQKFLPPNASTWERIIPELCKPKKVQAIIDKCWSSLF 643 >emb|CBI27232.3| unnamed protein product [Vitis vinifera] Length = 660 Score = 67.0 bits (162), Expect = 1e-09 Identities = 31/55 (56%), Positives = 42/55 (76%) Frame = -3 Query: 309 QLVKRRRIFAASKIVEVMLQKYFSPKASTWGRVVKDLCRHRKVQAGIELCRSKLF 145 +L KR+RI A+KI+EVMLQK+ P ASTW R++ +LC+ +KVQA I+ C S LF Sbjct: 605 RLHKRQRIVGAAKIIEVMLQKFLPPNASTWERIIPELCKPKKVQAIIDKCWSSLF 659